PRGDB00047454 (OSJNBa0083K01.34)

From PRG Wiki
Jump to: navigation, search
OSJNBa0083K01.34
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 41237094 (AC147962)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 3 BAC OSJNBa0083K01 genomic sequence, complete sequence.

DNA Sequence

TTACATGAGTCTAAAGATGCTTGGTATGAAGAGCAACAAGCTCTGAATGAATTGAATGATGCAAGTGAGGACGAGCACAGAGAGGAGTTTGGGCTTTTGTACGAAGATGACAATGGAGAGGACAACGATGAGCAAGACCATGAGCAGTCAGAAGATGAGGAAATTCAGTACGGCAGTGATGACAGTAGCGAAGAGGATGAATAGGAACCTGAACCATCCCCTATCAAAGTTCCTGTTCCAGATGATTTGGCAGCAAGGGTGAGGAAAATTTTAGAAAAATTCAATGAGATCACAAAGGCATGGGATGATCTCCAACTCAATGAGAGTGACGCACCAATAAGAGAGGAGGCCTATGACATCAAGATATCTACAACCCCGCATGTAGGTGATTTTGACATAGTTGGTAGAGAAGAAGACAAGGAAAACATCATCGAAATATTAATTTCCGATGAAGCTGCTCAAGCAAATATGTCTGTTGTTTCTATTGTTGGCATGGGGGGTTTGGGTAAGACAACTCTTGCTCAAATGGTGTACAATGATGAAAGAGTCAGCAGGTACTTTCAACTAAAGGGCTGGGTGGATGTTTCTGAGGGTCATTTTGATGTTAAGGCAATTGCAAGAAAAATTATCATGTCGTTCACTAGGAATCCATGTGATATAGAAGATATGGGTAATCTCCAAAATATGATAACGGCGCAAGTACAAGACATGAAGTTCTTTCTAGTTCTTGACAATGTGTGGAATGTGCAGAAGGAAATCTGGGATGCTTTGCTTTCCCTGTTGGTGGGTGCTCAGTTGGGAATGATCTTATTAACAACACGCGATGAAACTATTTCAAAAATGATAGGAACAATGCCTTCTTATGATCTTAGCTTCCTAACTTCTGAAGAATCATGGCAGTTGTTCAAGCAGATGGCCTTTGGATTTATAGATCAACATATGGATCAACAGTTCGAAGGATTTGGTAGGAAAATTGTGGGAAAATGTGGAGGCCTACCATTGGCAATTAAGGCAATAGGATCCTCTCTTCGCGGTGAGACAAATGAAGAGACATGGAAAGATGTCTCAGAGAGTGATCAATGGGGCTTACCTGCGGAAGAGGATCGAGTGCTGCCAGCACTAAAACTCAGCTATGATCGAATGCCAGTACAATTGAAGCGCTGCTTTGTTTTCCTTTCACTGCTCCCTAAGGGGTACTATTTCTGGAAAGAAGACATGATAAATCTCTGGATGTGTTTGGGACTCCTCAAGCAATATTGTACTGGGCGCCATGAAAACATTGGCAGGATGTACTTCGATGATTTAATTCAGAGGGCAATGATTCAACGAGCAGAATCTGATGAAAAACTGGAATGCTTTGTCACACATGATCTTATCCATGATCTGGTACATTTTGTTTCTGGAGGAGATTTCTTGAGAATAAATACTCAATATTTGCATGAAACCATTGGAAACTTCCGCTACTTGTCATTGGTTGTCAGTTCTTCTGATCATACAGATGTAGCACTAAATTCTGTGACGATACCTGGAGGTATAAGAATCCTTAAGGTTGTCAATGCACAAGATAATCGAAGATGTTCCAGTAAGTTGTTTTCTAGTAGCATCAATGTTAAAATTCCTACCGAAACATGGCAAAATCTTAAACAACTTCGTGCATTGGATTTCAGTCATACTGCACTTGCACAAGTACCTGATTCAATAGGAGAATTGAAACTACTCAGATATCTTAGCTTTTTCCAAACACGAATTACCACTATCCCAGAATCAATTAGTGACCTCTACAATCTGAGGGTCTTGGATGCAAGAACGGACAGCCTTAGAGAGCTCCCACAAGGCATAAAAAAACTGGTCAACCTCCGCCATCTCAATTTGGATCTTTGGTCCCCACTTTGCATGCCATGTGGGATAGGTGGGCTAAAAAGGCTACAGACATTGCCAAGGTTTAGCATTGGAAGCGGAGGTTGGCATTCCAATGTTGCCGAGCTACACCATCTGGTGAACATACATGGAGAGTTATGTATTACAGGACTACGGAGGGTTATAAATGTTGATGATGCTCAGACAGCTAATTTAGTCAGTAAGAACCAATTGCAAATCCTGAGATTAGACTGGTCTGATGGTGTTTGCCCCAACAACTGCAGTCATCCTAGCAGCCAAAATGATGTGGCTACCCCAGACCCAGAGCATGAGGAAGAGATCTTTGAGAGCCTACGGCCGCACAAGAACATCGAAGAATTGGAGGTAGTCAATTATAGTGGATACAAATATCCTAGCTGGTTTGGGGCTTCTACCTTCATGCACTTGGCAAAGATAATCCTATGTCAGCAAAGCTGCAAGTTCCTTCCTCCACTTGGGGAATTGCCACGCCTCCGCATACTCTCTATGGAGTGCATGACAGATGTGGAGCATGTGCGACAGGAGTTCCGTGGAAACATCACCACAAAGGCATTCCCAGCTGTTGAGGAGCTGGAGTTTCAAGAAATGTTGAAATGGGTTGAGTGGTCTCAAGTTGGTCAGGATGACTTTCCTTCACTCCGCCTGCTAAAAATCAAGGATAGCCACGAGTTGAGGTACCTCCCACAGGAGCTATCTTCCTCCCTCACAAAGTTAGTTATCAAGGATTGCAGCAAACTTGCTAGTCTACCAGCTATTCCAAACCTCACTACTTTGGTCTTGAAGAGCAAGATAAATGAACAAATTCTGAATGATTTGCACTTTCCGCATCTCAGATCACTGAAAGTGTTACTGTCACGGAGCATCGAGCACCTTTTACTTGACAATCAGAATCACCCATTGCTCGAAGTCTTGGTTATCAGTGTTTGCCCACGTCTTCACTCTATAATGGGTCTTAGCAGCCTTGGGTCACTCAAATTTTTGAAGATACATAGATGTCCTTATCTGCAGCTACCATCTGATAAACCACTGTCAACACAGCTTCAGCGACTTACCATCACAAAGTGCCCATTGCTAGCAGACTGGTTGGAAGTCCAAATTTCGCACCAGCAATGCCAGATGGCTGGACTACTAGCATCTGGAATCATAAAGTGGACAACAAACAAGCTTTCTTCCTTGGTTTCTCCTCAAATCGTTTCATCATCATCTGACGAGCAAAGTGCTTCGTTCAGAGATCTAAGAGATCTGCAGAGGACGATGGCAAGGATTCAGCGGACCCTCGATGCGATGGATGAACACAATATAAGAGATGAAGCCGAGAGACTTCGCCTGTGGGAGCTGCAGCAGCTTGCATATGATGCCCAGGATGCTGTCGATGAATACAGGTATGAGTTGCTTCGACGGAGGATGGAGGACCAAAGCAATCAAAGGCAGAGCAGCAGAAGTCGCAAGCGCAAGCGCAAAGGTGACAAGAAG


Protein sequences

Name Description Sequence
putative NBS-LRR type disease resistance protein putative NBS-LRR type disease resistance protein [Oryza sativa (japonica cultivar-group)].

MAGLLASGIIKWTTNKLSSLVSPQIVSSSSDEQSASFRDLRDLQRTMARIQRTLDAMDEHNIRDEAERLRLWELQQLAYDAQDAVDEYRYELLRRRMEDQSNQRQSSRSRKRKRKGDKKEPEPSPIKVPVPDDLAARVRKILEKFNEITKAWDDLQLNESDAPIREEAYDIKISTTPHVGDFDIVGREEDKENIIEILISDEAAQANMSVVSIVGMGGLGKTTLAQMVYNDERVSRYFQLKGWVDVSEGHFDVKAIARKIIMSFTRNPCDIEDMGNLQNMITAQVQDMKFFLVLDNVWNVQKEIWDALLSLLVGAQLGMILLTTRDETISKMIGTMPSYDLSFLTSEESWQLFKQMAFGFIDQHMDQQFEGFGRKIVGKCGGLPLAIKAIGSSLRGETNEETWKDVSESDQWGLPAEEDRVLPALKLSYDRMPVQLKRCFVFLSLLPKGYYFWKEDMINLWMCLGLLKQYCTGRHENIGRMYFDDLIQRAMIQRAESDEKLECFVTHDLIHDLVHFVSGGDFLRINTQYLHETIGNFRYLSLVVSSSDHTDVALNSVTIPGGIRILKVVNAQDNRRCSSKLFSSSINVKIPTETWQNLKQLRALDFSHTALAQVPDSIGELKLLRYLSFFQTRITTIPESISDLYNLRVLDARTDSLRELPQGIKKLVNLRHLNLDLWSPLCMPCGIGGLKRLQTLPRFSIGSGGWHSNVAELHHLVNIHGELCITGLRRVINVDDAQTANLVSKNQLQILRLDWSDGVCPNNCSHPSSQNDVATPDPEHEEEIFESLRPHKNIEELEVVNYSGYKYPSWFGASTFMHLAKIILCQQSCKFLPPLGELPRLRILSMECMTDVEHVRQEFRGNITTKAFPAVEELEFQEMLKWVEWSQVGQDDFPSLRLLKIKDSHELRYLPQELSSSLTKLVIKDCSKLASLPAIPNLTTLVLKSKINEQILNDLHFPHLRSLKVLLSRSIEHLLLDNQNHPLLEVLVISVCPRLHSIMGLSSLGSLKFLKIHRCPYLQLPSDKPLSTQLQRLTITKCPLLADWLEVQISHQQCQLHESKDAWYEEQQALNELNDASEDEHREEFGLLYEDDNGEDNDEQDHEQSEDEEIQYGSDDSSEEDE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
38-1018 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RDLRDLQRTMARIQRTLDAMDEHNIRDEAERLRLWELQQLAYDAQDAVDEYRYELLRRRMEDQSNQRQSSRSRKRKRKGDKKEPEPSPIKVPVPDDLAARVRKILEKFNEITKAWDDLQLNESDAPIREEAYDIKISTTPHVGDFDIVGREEDKENIIEILISDEAAQANMSVVSIVGMGGLGKTTLAQMVYNDERVSRYFQLKGWVDVSEGHFDVKAIARKIIMSFTRNPCDIEDMGNLQNMITAQVQDMKFFLVLDNVWNVQKEIWDALLSLLVGAQLGMILLTTRDETISKMIGTMPSYDLSFLTSEESWQLFKQMAFGFIDQHMDQQFEGFGRKIVGKCGGLPLAIKAIGSSLRGETNEETWKDVSESDQWGLPAEEDRVLPALKLSYDRMPVQLKRCFVFLSLLPKGYYFWKEDMINLWMCLGLLKQYCTGRHENIGRMYFDDLIQRAMIQRAESDEKLECFVTHDLIHDLVHFVSGGDFLRINTQYLHETIGNFRYLSLVVSSSDHTDVALNSVTIPGGIRILKVVNAQDNRRCSSKLFSSSINVKIPTETWQNLKQLRALDFSHTALAQVPDSIGELKLLRYLSFFQTRITTIPESISDLYNLRVLDARTDSLRELPQGIKKLVNLRHLNLDLWSPLCMPCGIGGLKRLQTLPRFSIGSGGWHSNVAELHHLVNIHGELCITGLRRVINVDDAQTANLVSKNQLQILRLDWSDGVCPNNCSHPSSQNDVATPDPEHEEEIFESLRPHKNIEELEVVNYSGYKYPSWFGASTFMHLAKIILCQQSCKFLPPLGELPRLRILSMECMTDVEHVRQEFRGNITTKAFPAVEELEFQEMLKWVEWSQVGQDDFPSLRLLKIKDSHELRYLPQELSSSLTKLVIKDCSKLASLPAIPNLTTLVLKSKINEQILNDLHFPHLRSLKVLLSRSIEHLLLDNQNHPLLEVLVISVCPRLHSIMGLSSLGSLKFLKIHRCPYL

superfamily: SSF52540
183-417 SSF52540

DIVGREEDKENIIEILISDEAAQANMSVVSIVGMGGLGKTTLAQMVYNDERVSRYFQLKGWVDVSEGHFDVKAIARKIIMSFTRNPCDIEDMGNLQNMITAQVQDMKFFLVLDNVWNVQKEIWDALLSLLVGAQLGMILLTTRDETISKMIGTMPSYDLSFLTSEESWQLFKQMAFGFIDQHMDQQFEGFGRKIVGKCGGLPLAIKAIGSSLRGETNEETWKDVSESDQWGLPAE

Gene3D: G3DSA:3.40.50.300
185-337 G3DSA:3.40.50.300

VGREEDKENIIEILISDEAAQANMSVVSIVGMGGLGKTTLAQMVYNDERVSRYFQLKGWVDVSEGHFDVKAIARKIIMSFTRNPCDIEDMGNLQNMITAQVQDMKFFLVLDNVWNVQKEIWDALLSLLVGAQLGMILLTTRDETISKMIGTMP

HMMPfam: PF00931
IPR002182
187-469 NB-ARC,NBS
NB-ARC

REEDKENIIEILISDEAAQANMSVVSIVGMGGLGKTTLAQMVYNDERVSRYFQLKGWVDVSEGHFDVKAIARKIIMSFTRNPCDIEDMGNLQNMITAQVQDMKFFLVLDNVWNVQKEIWDALLSLLVGAQLGMILLTTRDETISKMIGTMPSYDLSFLTSEESWQLFKQMAFGFIDQHMDQQFEGFGRKIVGKCGGLPLAIKAIGSSLRGETNEETWKDVSESDQWGLPAEEDRVLPALKLSYDRMPVQLKRCFVFLSLLPKGYYFWKEDMINLWMCLGLLKQ

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

VVSIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
284-298 DISEASERSIST
Disease resistance protein

QVQDMKFFLVLDNVW

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

CGGLPLAIKAIGSSL

superfamily: SSF52058
505-911 SSF52058,LRR

VTHDLIHDLVHFVSGGDFLRINTQYLHETIGNFRYLSLVVSSSDHTDVALNSVTIPGGIRILKVVNAQDNRRCSSKLFSSSINVKIPTETWQNLKQLRALDFSHTALAQVPDSIGELKLLRYLSFFQTRITTIPESISDLYNLRVLDARTDSLRELPQGIKKLVNLRHLNLDLWSPLCMPCGIGGLKRLQTLPRFSIGSGGWHSNVAELHHLVNIHGELCITGLRRVINVDDAQTANLVSKNQLQILRLDWSDGVCPNNCSHPSSQNDVATPDPEHEEEIFESLRPHKNIEELEVVNYSGYKYPSWFGASTFMHLAKIILCQQSCKFLPPLGELPRLRILSMECMTDVEHVRQEFRGNITTKAFPAVEELEFQEMLKWVEWSQVGQDDFPSLRLLKIKDSHELRYLP

Gene3D: G3DSA:3.80.10.10
588-681 G3DSA:3.80.10.10

VKIPTETWQNLKQLRALDFSHTALAQVPDSIGELKLLRYLSFFQTRITTIPESISDLYNLRVLDARTDSLRELPQGIKKLVNLRHLNLDLWSPL

FPrintScan: PR00364
IPR000767
596-612 DISEASERSIST
Disease resistance protein

QNLKQLRALDFSHTALA

Gene3D: G3DSA:3.80.10.10
782-847 G3DSA:3.80.10.10

EEIFESLRPHKNIEELEVVNYSGYKYPSWFGASTFMHLAKIILCQQSCKFLPPLGELPRLRILSME

superfamily: SSF52058
782-1066 SSF52058,LRR

EEIFESLRPHKNIEELEVVNYSGYKYPSWFGASTFMHLAKIILCQQSCKFLPPLGELPRLRILSMECMTDVEHVRQEFRGNITTKAFPAVEELEFQEMLKWVEWSQVGQDDFPSLRLLKIKDSHELRYLPQELSSSLTKLVIKDCSKLASLPAIPNLTTLVLKSKINEQILNDLHFPHLRSLKVLLSRSIEHLLLDNQNHPLLEVLVISVCPRLHSIMGLSSLGSLKFLKIHRCPYLQLPSDKPLSTQLQRLTITKCPLLADWLEVQISHQQCQLHESKDAWYEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox