PRGDB00047456 (RPM1)

From PRG Wiki
Jump to: navigation, search
RPM1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 47059738 (AY599223)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Prunus persica

Comment?

Prunus persica putative NBS-LRR type disease resistance protein (RPM1) mRNA, complete cds.

DNA Sequence

ATGGACTCAGCTCCAACAGCTCTCTTGGTTGGCAAAATTATGGACATTCTCGAGAACGAAGCATACTCCATAGCCGCTGTCCGTGATGAAGTTGATGAGATTAAGCAGGAGCTGGTAAGCATGACATCCTTCCTAGAGGATGTTGAGGGCAAGAAAACACAGACAGAAACACAGAAAGCTTGGGTCACAAGTGTCAAAGACTTAACCAGTGATGTTGAAGATATCATCGATGAATTCATGTATCATACGTATGAGCAGCAAAGTAGGGGACGATTTGCAAGGTGGCTCCACAGGACCATTCATATTCCAAAGAATCTCTTCTATCGGCGTAAAATTGCCAACAAGTTACACAAAATCACTAAAATGATCAAGGCCATTCCAGAGAGAAATAGGAGATATGCTCTTGATGGTGTAGTAGGAACAAGTTGGGATGATATTAGCAAATGGGTCAAGAACCAAGCAGTGTCTTCTCTCTTTATTAACAAAGATGAACTCGTCGGGATTGATGGAAAGAAGCAAACATTAACTGCATGGCTGCTCAATGAAGAGCAGCACCTAACTGTTGTCTCCGTGGTCGGGATGGGAGGATCCGGGAAAACAACTCTAGTTGCCAAAACCTTCGCCAACGAAACTGTAAAGAGACATTTTGATTCTTATGCTTGGATCACTGTCTCCCAAACTTATGTGATTGAAGACTTGTTTCGGAGCTTGATCAAGGAACTCCACCAAACAAGGAAAGAAGATGTCCCTGCAGACCCGATATCCATGAGCTACAGAGACTTGCTACAACTTCTGGTGAACTACCTGGAGTCTAAAAGGTACCTAGTAGTACTGGATGACGTGTGGGATATCAAACTTTGGAGAGAAATAAGGATAGCACTTCCAGATAGACAGCTTGGAAGTCGAATCATGCTTACAACTCGAAAAGAAGACATAGCATCCCATTGTTTTGGAGTTGAAAGCCATGTTCACTGTATGCAACCGCTGGAAAAGAATTACGCTTGGGAGCTTTTCAGCAGGAAATCATTCTCTACCTTTGATGGTAAATGTTGTCCACCAGAGCTTGAAAAATTAGCTTGGGAACTCATGGAAAAGTGTAAAGGCCTACCTCTAGCTATCATAGCTTTAGGTGGTCTTATGTCTTCCAAGAAATTAGCTGCGGAGTGGAGTAAAGTCTACAATGGCTTAAATTGGCATCTAACAAGCCATCATTTGTTAGAACCTGTGAAGAGCATCTTGTTACTTAGTTTCAATGATTTGCCATATCGCTTGAAGCATTGTTTTCTATATTGTTCCCTTTTTCCAGAAGATTATTTGATTCGAAGGAAAAGGCTCATTAGGTTATGGATAGCTGAAGGATTTGTTGAACATGCTAGAGGGGTCACACCTGAACAAGTTGCAGATAGCTATCTTATGGAACTCATTTTTCGTAACATGCTACAAGTTGTAGAGAGGAATGAAACCGGTAGGCCAAAATCATGTAAGATGCATGACCTTATGCGAGAGCTTGCTCTGTCAACATCTGAGAAAGAAAAATTTTCTATTGTACATGATGGGAAAGAAGTACTGGAAGACATTGGAGCCCGCCGTTTGTCAATCCAAACAACCCAAGGAGGAATTGAATCTTGCATTGGTATGTCACGCCCTCGTTCTTTTCTTGTATTCGTTACTGGCATATTCTCATTTTCTTTCTCAAAGTCATTGCCTTCTGGATTCAAATTGTTGAGGGTTTTAGATTTGGAGGATGTCCAAATTGATAAGCTGCCACATAATTTAGTGTACTTATTCAACTTAAGATACTTAAGTTTGAAGGGAACTCAAATTAAGGAGCTTCCAAAAGCCATAGGACTGCTCCGCAACCTTCAGACATTGAACATCCTCAATACTAAGATAGAGGTACTTCCCAGAGGTATTTCCAAGTTGCAAAACCTGCGCCATCTAATTATGCTCCGTCATTCTGGAGAGTATATGGCCTTCAAAACTGCCCATGGGACAAGAGTGCCATTTAATATTAGTAAGCTGAAGAAATTGGAAGTTTTGTCATGTGTTGAATCAGAAGGAAACATTATAAGGCTCATTGGGAATATGACTCAACTTACAAGGATTGGCATTACGAATGTAAAAGAGAGAGACGCAATGGACCTATGTGATTCAATTCAAAAGTTGAAGCTACTTCAGTGCTTGGCTTTAAGGGTAAGTGGTGAGGAGGAGTTTCTTGACGTCAATGCATTATCTTCACCTCCTCCACACCTTCGAAAACTTATTTTTGGCAGCAAGCTGCAAAAGGTACCACCTTGGTTCTCTTCGCTCCAGAACCTTACATATCTGTATCTTCATTGGACGAGACTTGACGAGGATTTACTACCTCATATTGAAGCATTGCCATGTCTGGGAAGGCTTTTACTTGTCAATGCCTATGTTGGTAATGAGTTGTGTTTCAACAGAGGCTTTCCAAAGCTTACTATTCTGGAGTTGTTTAATTTCCCCTTATTGAATAAGATAACTATAGCAGAAGGGGTGATGAGGAATCTCCGGTTATTAACACTTGCTAGATGTATGGAGTTAAAGGCATTGCCACAGGGTTTTGAATACCTTAGTAAGCTAGAAACACTTGAATTGTTGTCTGTTTCAATGCAACTTATAGAGTCCATACAAGAAGGAGGGGTGGATCATCCAACGGTAAAACACATCACCGTCATTACAAATTATTCTTTGAAATGCTTGATAAGAGCTCATCATAGTTCATCCACATGA


Protein sequences

Name Description Sequence
putative NBS-LRR type disease resistance protein putative NBS-LRR type disease resistance protein [Prunus persica].

MDSAPTALLVGKIMDILENEAYSIAAVRDEVDEIKQELVSMTSFLEDVEGKKTQTETQKAWVTSVKDLTSDVEDIIDEFMYHTYEQQSRGRFARWLHRTIHIPKNLFYRRKIANKLHKITKMIKAIPERNRRYALDGVVGTSWDDISKWVKNQAVSSLFINKDELVGIDGKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTSHHLLEPVKSILLLSFNDLPYRLKHCFLYCSLFPEDYLIRRKRLIRLWIAEGFVEHARGVTPEQVADSYLMELIFRNMLQVVERNETGRPKSCKMHDLMRELALSTSEKEKFSIVHDGKEVLEDIGARRLSIQTTQGGIESCIGMSRPRSFLVFVTGIFSFSFSKSLPSGFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHLIMLRHSGEYMAFKTAHGTRVPFNISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELLSVSMQLIESIQEGGVDHPTVKHITVITNYSLKCLIRAHHSSST

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF234
2-903 PTHR23155:SF234,RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1)

DSAPTALLVGKIMDILENEAYSIAAVRDEVDEIKQELVSMTSFLEDVEGKKTQTETQKAWVTSVKDLTSDVEDIIDEFMYHTYEQQSRGRFARWLHRTIHIPKNLFYRRKIANKLHKITKMIKAIPERNRRYALDGVVGTSWDDISKWVKNQAVSSLFINKDELVGIDGKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTSHHLLEPVKSILLLSFNDLPYRLKHCFLYCSLFPEDYLIRRKRLIRLWIAEGFVEHARGVTPEQVADSYLMELIFRNMLQVVERNETGRPKSCKMHDLMRELALSTSEKEKFSIVHDGKEVLEDIGARRLSIQTTQGGIESCIGMSRPRSFLVFVTGIFSFSFSKSLPSGFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHLIMLRHSGEYMAFKTAHGTRVPFNISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELLSVSMQLIESIQEGGVDHPTVKHITVITNY

HMMPanther: PTHR23155
2-903 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DSAPTALLVGKIMDILENEAYSIAAVRDEVDEIKQELVSMTSFLEDVEGKKTQTETQKAWVTSVKDLTSDVEDIIDEFMYHTYEQQSRGRFARWLHRTIHIPKNLFYRRKIANKLHKITKMIKAIPERNRRYALDGVVGTSWDDISKWVKNQAVSSLFINKDELVGIDGKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTSHHLLEPVKSILLLSFNDLPYRLKHCFLYCSLFPEDYLIRRKRLIRLWIAEGFVEHARGVTPEQVADSYLMELIFRNMLQVVERNETGRPKSCKMHDLMRELALSTSEKEKFSIVHDGKEVLEDIGARRLSIQTTQGGIESCIGMSRPRSFLVFVTGIFSFSFSKSLPSGFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHLIMLRHSGEYMAFKTAHGTRVPFNISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELLSVSMQLIESIQEGGVDHPTVKHITVITNY

superfamily: SSF52540
148-402 SSF52540

KWVKNQAVSSLFINKDELVGIDGKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTS

Gene3D: G3DSA:3.40.50.300
170-314 G3DSA:3.40.50.300

GKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIAS

HMMPfam: PF00931
IPR002182
171-457 NB-ARC,NBS
NB-ARC

KKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTSHHLLEPVKSILLLSFNDLPYRLKHCFLYCSLFPEDYLIRRKRLIRLWIAEGFVEH

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VVSVVGMGGSGKTTLV

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

YLESKRYLVVLDDVW

FPrintScan: PR00364
IPR000767
366-380 DISEASERSIST
Disease resistance protein

CKGLPLAIIALGGLM

superfamily: SSF52058
495-909 SSF52058,LRR

KMHDLMRELALSTSEKEKFSIVHDGKEVLEDIGARRLSIQTTQGGIESCIGMSRPRSFLVFVTGIFSFSFSKSLPSGFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHLIMLRHSGEYMAFKTAHGTRVPFNISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELLSVSMQLIESIQEGGVDHPTVKHITVITNYSLKCLI

Gene3D: G3DSA:3.80.10.10
566-648 G3DSA:3.80.10.10

KSLPSGFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHLI

Gene3D: G3DSA:3.80.10.10
671-874 G3DSA:3.80.10.10

ISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELL

FPrintScan: PR00364
IPR000767
839-855 DISEASERSIST
Disease resistance protein

GVMRNLRLLTLARCMEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox