PRGDB00047478 (OSJNBb0111K12.18)

From PRG Wiki
Jump to: navigation, search
OSJNBb0111K12.18
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32401478 (AC121366)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome 5 clone OSJNBb0111K12, complete sequence.

DNA Sequence

ATCTCCCATCCTCCCTTCAGCGCATATCCATAGTGGACTGCCCCAATATATCATCTTTGCCAGATCTCCCATCCTCCCTGCAGCACATATACATACGTGACTGTCCACTACTGAAGGAGAGCTGTAGAGTACCCGATGGGGAAAGCTGGCCAAAGATTGCGCATATTCGTTGGAAGCGTATTGACTGAATGCACTGTCATCGGATCATTCATCTATGAAGCAGTTGGCAGCATTGATGGACTCTGATATATCAAAAAATCTTCAAACCATTGAACGCGCTCTAGAAAGAGAAGATGAAGTAGTGATGACCAAGGATGTCATCAAGGCATGGATGCGTTGCCACGAGCAGAGGATGAGACTCATTTATGCAAGGAGGATTGGGCTACCATTGGTCCCACCGTCAGGACTTAGTGATCTCTCCCTTAAATCATGCACAATTACAGATACAGCTCTATCCATATGCCTTGGTGGCCTAGCTTCTCTGAGATGTTTGTCCTTATCCAAGATCATGTCTTTAACTACTCTTCCGTCAGAAGAGGTCCTGAAAAAATTGACAAAGCTTGATTGTTTGATCATTGATGCCTGCTTGTTTCTCGGATCGTTGGGGGGCTTGCGAGCTGCTACTTCCCTTTCGCATTTAAGGTTGAACTCTTGCCCTGCTTTAGAGTTGGCACACGGTGCAGAATTCATGCCAGCGTCCCTTAAGAGACTCGCAATAAGTTGTTGTGTGCTTGCACCCGACTTGTTCTGTGGCCACTGGCCGCATCTGAAAGATATTTTCATACACGACTGCAGAAGCTCTGTGTCGTTGTTTGTTGGTGATCTTAGCTCCCTGAAAGAATTCACACTTTATCATTTGCCAGATTTATGTGTGCTTGAAGGCCTGTCTTCCCTTCAACTTCACAGCGTGTGTTTGGTAGATATCCCGAAGCTTACTGCTGAGTGTGTGTCAAAGTTTCGTGTCCAGGATTTACTGCATGTTAGCAGCTCTGCGGTGTTGAACAACATCATCTCGGCTGAAGATGGCGGAAGTGGCATTGGCTAGCTTACGATTGGCAGCATCACCGATCCTGAACAAGCTCCTCGCTGACGCTTCAACATACCTTGGAGTGGACATGGCGAGTGAGCTCCGTGAACTGGAGACCAGCATCATGCCGCAGTTCGAGCTGTTGATTGAAGAAGCTGAGAAGGGCAACCACAGGGCCAAGCTGGACAAATGGATACGGGAGCTCAAAGAAGCCTTGTACAATGCCGAGGACCTGCTGGATGAGCATGAGTACGACATCCTCAAGCGCAAGGTGAAGAACGGAGGCGAGGATCCTTCTCCAGATCTAGAGCATGCCTCCTCCATCGGTTCCATCATTAAGAAACCTATGCGCGCAGCATCAAGCAGCTTGTCCAATCTGCGACCGAAGAACATAAAGCTTGTACGCCAGCTGAAGGAGCTCAAGGCCATCCTAGCGAAAGCAAGGGACTTCCGTGAAATGCTTGGCTTACCGGCTGGTAGCAGTGTAGAGGGGGCACAAACTGGACATACAAAAACAGTGGTCGTTACTGCAGCGACATCAACCCCACCACCAAAGGTGTTTGGTCGCGACGCGGACCGCGATCGCATTGTTGATCTTCTTACCCAACACAAGACTTGTGCTGAGGCTAGCCGTTTCGTTGTCTCCATTGTTGGACCTGGAGGCATGGGGAAATCCACCTTGGCTCAGTATGTTTACAATGACAAGACGATACAAGAACATTTTGACGTCACGATGTGGGTTTGCATCTCACGCAAACTTGATGTCCATCGTCATACAAGGGAGATCATCGAGTCTGCAACAAAAGAGAAGTGTCAAAGGGTTGGTAATATGGACGTTCTCCAGTACAAACTAAAAGAAATACTGCAGAAAAAAGAGAAAGTCCTGCTTGTGTTGGACGACATTTGGTTCGATAAATCCCAGGACGTTGAGGAATGGGACCTGCTACTTGCTCCCATACTATCTTCTCAGAATGGGGCAACCAAAGTTCTGGTAACTTCTCGATCTAAGACACTTCCACCTGCTCTTTTCTCTGAAGATGTCATTGATTTGGAAAATATGAAAGATACTGAGTTCCAGGCACTCTTCAAACACCATGCTTTCTCTGGAGCCACAATTCGAGACCTCCAGATGTGTGGCTGGTTCGAAGAGCATGCAGTGAAGATTACTGAAAGGCTTGGAAGATCTCCTTTGGCAGCAAAAGTTGTAGGTTCCAACTTGAAAAGGGTGATGAATATCGATGATTGGAAAGGTGCTCTCACTATAAAGATAGACAATTTAAGTGAACCTAAGAGAGCTCTGTTGTGGAGTTATCAGAAATTAGATCCATGTCTTCAGAGATGCTTTCTGTATTGCAGTTTATTTCCAAAAGGTTACAAATACATAATTGACGAGTTGGTTCACCTTTGGGTTGCAGAGGGATTTATTGATGCACGTGATACGAATAAAAGAATGGAAGATACCGGCATGGATTACTTCAAAGAGATGGTCTCTGGATCCTTTTTCCAACCATTTTCTGAAAGATTTGATAGTACGGTGTACATTATGCATGACCTCCTTCATGATTTGGCAGAGTCACTCTCTAGAGAAGACTGCTTCAGATTAGAAGATGACAAGGTGAGAGAAATACCATGCACTGTTCGGCATTTATCTGTTCGTGTTGAGAGTATTATACAACATAAGCCAAGTGTCTGCAAGCTACAACATTTGCGAACTCTTATCTGCATTGACCCACTAGTGGATGTTGGGAGCAATATTTTCGAGCAGGTAGTATTGAATCTGAAGAAGTTACAAGTACTTTATTTGTCGTTTTACAACACTAGAAAGTTGCCAGAATCAATCGGTCAGCTAAAGCATCTTCGGTATTTGAACATCAAGAAGACATTGATTTCTGAACTACCAAAATCATTATGCGATCTTTACCATTTAGAGTTACTTTATTTGCGTCCGAAATCGAGGTTACCTGACAAACTCTGCAATTTATGTAAGTTACGACATCTTCAAATGTACTCTGATGGATTGGAGCTGTCACGGATTCCTGACATAGGCCGGCTAACTTTGCTTCAACGTATTGATAGTTTTCACGTCCTAAAACAGAAGGGACATGAGTTGCGACAGCTCAGGAACATGAACGAAATTGGTGGGTATTTATCGCTCAGAAATCTTGAGAATGTGATTGGCAAGGATGAAGCTTTAGAGTCGAAGCTGTATCAGAAAAGTCGTCTTGAAGGATTGACGCTTGAGTGGAATGATGCGAATAACATGAATCCAGAGAATTGTTTACATGTTGAGATTCTTGAAGGCCTCGTGCCACCACCACAGTTGGAGCACTTATCAATTAGAGGTTACAAATCGACTACCTATCCAAGCTGGTTACTCGAGGGTTCCCAGCTTGAGAATCTAGAATCCTTTGCTCTTTATAACTGCAGCGCTTTAGAAAGGCTACCATCCAATACCAAGCTCTTTAGGCGTTGCCGTGAATTGAGCCTTAAGAATCTCCCGAATATGAAGGAACTATCATTTCTTCCAGCAGGTCTCACAACGTTGTCAATTCGTAGGTGCCCACTGCTTCTCTTCGTTACCAATGATGAACTGGAGTATCATGATCATA


Protein sequences

Name Description Sequence
putative disease resistance protein, contains NBS-LRR domain putative disease resistance protein, contains NBS-LRR domain [Oryza sativa (japonica cultivar-group)].

MAEVALASLRLAASPILNKLLADASTYLGVDMASELRELETSIMPQFELLIEEAEKGNHRAKLDKWIRELKEALYNAEDLLDEHEYDILKRKVKNGGEDPSPDLEHASSIGSIIKKPMRAASSSLSNLRPKNIKLVRQLKELKAILAKARDFREMLGLPAGSSVEGAQTGHTKTVVVTAATSTPPPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRALLWSYQKLDPCLQRCFLYCSLFPKGYKYIIDELVHLWVAEGFIDARDTNKRMEDTGMDYFKEMVSGSFFQPFSERFDSTVYIMHDLLHDLAESLSREDCFRLEDDKVREIPCTVRHLSVRVESIIQHKPSVCKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLYQKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLPSNTKLFRRCRELSLKNLPNMKELSFLPAGLTTLSIRRCPLLLFVTNDELEYHDHNALSSDHSSMKQLAALMDSDISKNLQTIERALEREDEVVMTKDVIKAWMRCHEQRMRLIYARRIGLPLVPPSGLSDLSLKSCTITDTALSICLGGLASLRCLSLSKIMSLTTLPSEEVLKKLTKLDCLIIDACLFLGSLGGLRAATSLSHLRLNSCPALELAHGAEFMPASLKRLAISCCVLAPDLFCGHWPHLKDIFIHDCRSSVSLFVGDLSSLKEFTLYHLPDLCVLEGLSSLQLHSVCLVDIPKLTAECVSKFRVQDLLHVSSSAVLNNIISAEDLPSSLQRISIVDCPNISSLPDLPSSLQHIYIRDCPLLKESCRVPDGESWPKIAHIRWKRID

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
4-923 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VALASLRLAASPILNKLLADASTYLGVDMASELRELETSIMPQFELLIEEAEKGNHRAKLDKWIRELKEALYNAEDLLDEHEYDILKRKVKNGGEDPSPDLEHASSIGSIIKKPMRAASSSLSNLRPKNIKLVRQLKELKAILAKARDFREMLGLPAGSSVEGAQTGHTKTVVVTAATSTPPPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRALLWSYQKLDPCLQRCFLYCSLFPKGYKYIIDELVHLWVAEGFIDARDTNKRMEDTGMDYFKEMVSGSFFQPFSERFDSTVYIMHDLLHDLAESLSREDCFRLEDDKVREIPCTVRHLSVRVESIIQHKPSVCKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLYQKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLPSNTKLFRRCRELSLKNLPNMKELSFLPAGLTTLSIRRCPLLLFVTNDELEYHDHNALSSDHSSMKQLAALMDSDISKNLQTIERALEREDEVVMTKDVIKAWMRCH

HMMPanther: PTHR23155:SF130
4-923 PTHR23155:SF130,OS01G0781700 PROTEIN

VALASLRLAASPILNKLLADASTYLGVDMASELRELETSIMPQFELLIEEAEKGNHRAKLDKWIRELKEALYNAEDLLDEHEYDILKRKVKNGGEDPSPDLEHASSIGSIIKKPMRAASSSLSNLRPKNIKLVRQLKELKAILAKARDFREMLGLPAGSSVEGAQTGHTKTVVVTAATSTPPPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRALLWSYQKLDPCLQRCFLYCSLFPKGYKYIIDELVHLWVAEGFIDARDTNKRMEDTGMDYFKEMVSGSFFQPFSERFDSTVYIMHDLLHDLAESLSREDCFRLEDDKVREIPCTVRHLSVRVESIIQHKPSVCKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLYQKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLPSNTKLFRRCRELSLKNLPNMKELSFLPAGLTTLSIRRCPLLLFVTNDELEYHDHNALSSDHSSMKQLAALMDSDISKNLQTIERALEREDEVVMTKDVIKAWMRCH

superfamily: SSF52540
171-435 SSF52540

HTKTVVVTAATSTPPPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRAL

Gene3D: G3DSA:3.40.50.300
185-344 G3DSA:3.40.50.300

PPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPAL

HMMPfam: PF00931
IPR002182
196-481 NB-ARC,NBS
NB-ARC

DRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRALLWSYQKLDPCLQRCFLYCSLFPKGYKYIIDELVHLWVAEGFIDARD

FPrintScan: PR00364
IPR000767
215-230 DISEASERSIST
Disease resistance protein

VVSIVGPGGMGKSTLA

FPrintScan: PR00364
IPR000767
290-304 DISEASERSIST
Disease resistance protein

LQKKEKVLLVLDDIW

FPrintScan: PR00364
IPR000767
394-408 DISEASERSIST
Disease resistance protein

LGRSPLAAKVVGSNL

superfamily: SSF52058
516-1074 SSF52058,LRR

IMHDLLHDLAESLSREDCFRLEDDKVREIPCTVRHLSVRVESIIQHKPSVCKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLYQKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLPSNTKLFRRCRELSLKNLPNMKELSFLPAGLTTLSIRRCPLLLFVTNDELEYHDHNALSSDHSSMKQLAALMDSDISKNLQTIERALEREDEVVMTKDVIKAWMRCHEQRMRLIYARRIGLPLVPPSGLSDLSLKSCTITDTALSICLGGLASLRCLSLSKIMSLTTLPSEEVLKKLTKLDCLIIDACLFLGSLGGLRAATSLSHLRLNSCPALELAHGAEFMPASLKRLAISCCVLAPDLFCGHWPHLKDIFIHDCR

Gene3D: G3DSA:3.80.10.10
566-738 G3DSA:3.80.10.10

CKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLY

Gene3D: G3DSA:3.80.10.10
739-856 G3DSA:3.80.10.10

QKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLPSNTKLFRRCRELSLKNLPNMKELSFLPAGLTTLSIRRCP

Gene3D: G3DSA:3.80.10.10
943-1189 G3DSA:3.80.10.10

SGLSDLSLKSCTITDTALSICLGGLASLRCLSLSKIMSLTTLPSEEVLKKLTKLDCLIIDACLFLGSLGGLRAATSLSHLRLNSCPALELAHGAEFMPASLKRLAISCCVLAPDLFCGHWPHLKDIFIHDCRSSVSLFVGDLSSLKEFTLYHLPDLCVLEGLSSLQLHSVCLVDIPKLTAECVSKFRVQDLLHVSSSAVLNNIISAEDLPSSLQRISIVDCPNISSLPDLPSSLQHIYIRDCPLLKE

FPrintScan: PR00364
IPR000767
965-981 DISEASERSIST
Disease resistance protein

GGLASLRCLSLSKIMSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox