PRGDB00047480 (NBS-LRR type disease resistance protein Hom-B)

From PRG Wiki
Jump to: navigation, search
NBS-LRR type disease resistance protein Hom-B
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 38373628 (AY452688)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Glycine max

Comment?

Glycine max cultivar Bonminori NBS-LRR type disease resistance protein Hom-B gene, complete cds.

DNA Sequence

ATGGCACTAGAATTGGTTGGTGGTGCTCTTCTTTCTGCTTTCCTTCAGGTTGCGTTTGAGAAGCTTGCTTCTCCTCAAGTTCTGGACTTCTTTCGTGGAAGAAAGCTTGATGAAAAGCTGCTCAACAACTTGGAAATCAAGCTGAACTCCATACAGGCTCTGGCTGATGATGCAGAACTAAAGCAGTTCAGAGATCCACCTGTCAGGAACTGGCTTCTTAAGGTCAAAGATGCTTTGTTTGACGCAGAGGATCTCTTGGATGAAATACAACATGAGATCTCCAAATGCCAGGTCGAAGCTGAAGCTGAAGCTGAGTCTCAAACCTGCACTTGCAAGGTACCAAATTTCTTCAAATCTTCTCCTGTTGGTTCCTTTAACAAGGAAATTAAATCAAGGATGGAACAGGTCCTTGAGGACCTTGAAAATCTTGCTAGCCAAAGTGGCTATCTAGGTTTGCAAAATGCAAGTGGTGTTGGATCAGGATTTGGTGGTGCAGTATCACTGCATTCAGAATCAACATCTTTGGTTGTTGAAAGTGTTATTTATGGCAGAGATGATGACAAAGAAATGATCTTTAATTGGCTCACATCTGACATTGACAATTGTAACAAACTATCAATACTTTCTATTGTGGGCATGGGTGGGTTGGGTAAGACCACACTTGCCCAACATGTATTCAATGACCCAAGGATAGAAAATAAATTTGATATCAAAGCTTGGGTCTGTGTTTCAGATGAATTTGATGTTTTCAATGTAACAAGAACAATTCTGGAGGCAGTCACTAAATCAACTGATGATAGTAGAAACCGAGAAACGGTTCAGGGAAGGTTGAGAGAAAAATTGACAGGAAATAAATTTTTTCTTGTTTTGGATGATGTTTGGAACAGAAATCAAAAGGAATGGAAAGATTTGCAAACTCCTCTTAATTATGGGGCTTCAGGGAGTAAAATTGTTGTCACTACACGTGACAAGAAAGTTGCTTCAATAGTGGGATCAAATAAAACACATTGCTTAGAGCTGTTGCAAGATGATCATTGCTGGCGATTGTTCACTAAACATGCATTCCGAGATGATAGTCATCAACCAAATCCAGACTTCAAGGAGATTGGTACGAAGATAGTAGAAAAATGTAAAGGACTGCCTCTGGCCTTGACAACAATTGGAAGTCTATTACACCAAAAATCATCTATTTCAGAATGGGAAGGCATATTGAAAAGCGAGATATGGGAATTTTCAGAAGAGGATAGCTCTATTGTCCCTGCTTTAGCACTAAGCTATCACCACCTTCCTTCCCATCTCAAGAGATGTTTTGCTTATTGCGCCTTATTCCCCAAAGATTACAGGTTTGACAAGGAGGGTTTAATTCAGCTGTGGATGGCGGAAAACTTTTTACAATGTCATCAACAGAGTAGGAGTCCAGAAAAAGTCGGTGAACAATACTTCAACGATCTTTTGTCAAGGTCCTTATTTCAACAATCAAGCACCGTAGAGAGAACACCTTTTGTCATGCATGACCTTCTCAATGATTTGGCAAAATATGTTTGTGGGGACATCTGCTTCAGGTTGGAAAATGATCAAGCAACAAATATACCGAAGACAACCCGTCATTTTTCAGTTGCAAGCGATCACGTTACATGCTTTGATGGGTTTCGAACTTTATACAATGCTGAAAGGTTACGCACATTTATGTCATTAAGTGAGGAAATGAGTTTTCGTAACTACAATCCTTGGTATTGCAAGATGTCAACACGTGAATTATTTTCCAAGTTTAAGTTCTTACGTGTCTTATCTCTGTCTGGTTATTATAACCTAACAAAGGTGCCTAACTCTGTGGGTAATCTTAAATATCTCAGTTCGTTAGACTTATCCCATACTGAAATAGTAAAACTACCTGAATCAATATGTTCACTCTACAACTTGCAAATACTGAAGCTAAATGGTTGTGAACATTTGAAGGAGCTGCCCTCAAATTTGCATAAACTCACTGATTTGCATCGCCTTGAATTAATAGATACTGAAGTGAGAAAGGTACCAGCACATTTGGGAAAACTGAAGTATCTTCAAGTATTAATGAGTTCGTTTAATGTTGGCAAAAGTAGGGAGTTCAGTATCCAGCAGCTAGGAGAACTCAATCTTCATGGAAGTCTATCAATAAGGCAACTGCAGAATGTTGAGAATCCATCAGATGCATTAGCGGTGGATTTAAAAAATAAAACACACCTTGTCGAGCTAGAGTTAGAATGGGATTCAGACTGGAACCCTGATGATTCAACAAAAGAAAGGGATGTAATCGAGAATCTACAGCCTTCCAAACACTTGGAGAAGTTGACGATGAGCAACTATGGGGGTAAACAATTTCCAAGGTGGTTATTCAACAATTCATTATTGCGTGTGGTATCCTTAACCTTGAAGAACTGTAAAGGTTTCCTATGTTTGCCTCCCCTTGGACGTTTGCCATCTCTGAAGGAGCTTTCAATTGAAGGGCTTGATGGGATTGTGAGTATTAATGCTGATTTTTTCGGGAGTAGCTCTTGTTCATTTACATCCTTGGAATCTTTGGAGTTCTCCGATATGAAGGAATGGGAAGAATGGGAATGTAAAGGTGTGACAGGTGCTTTTCCACGTCTTCAACGTCTTTCTATAATGCGTTGTCCCAAGCTGAAAGGGCACTTGCCAGAGCAACTATGTCATTTAAATTATCTAAAGATTTCTGGGTGGGACTCTCTAACGACTATTCCGCTAGATATCTTCCCAATACTCAAGGAGCTTCAGATCTGGGAGTGTCCTAATCTACAGAGGATTTCACAGGGGCAGGCTCTTAATCATCTCGAGACTCTGAGTATGAGAGAGTGCCCCCAATTAGAATCATTGCCTGAAGGAATGCATGTCCTCCTTCCATCTCTTGATTCTCTGTGGATAGATGATTGTCCAAAAGTTGAAATGTTTCCCGAAGGAGGTTTGCCATCAAATTTAAAAAGTATGGGTCTCTATGGTGGTAGTTACAAACTTATCTCCTTATTGAAAAGTGCCTTGGGAGGCAATCACTCTCTAGAAAGGTTAGTTATTGGAGGAGTGGATGTTGAGTGTCTTCCTGACGAAGGTGTACTGCCACACTCTCTTGTTAATCTATGGATAAGGGAGTGTGGAGATCTAAAAAGACTGGACTACAAAGGTCTCTGCCACCTCTCCTCTCTCAAGACATTGACTCTTTGGGACTGCCCCAGGCTCCAATGCTTACCAGAGGAGGGTCTGCCCAAATCCATTTCAACTTTGGGAATTCTCAATTGTCCGTTGCTCAAACAACGTTGCCGGGAACCCGAAGGCGAAGACTGGCCAAAGATTGCTCACATTGAAGAGGTGTTTATATGGAAGTGA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein Hom-B NBS-LRR type disease resistance protein Hom-B [Glycine max].

MALELVGGALLSAFLQVAFEKLASPQVLDFFRGRKLDEKLLNNLEIKLNSIQALADDAELKQFRDPPVRNWLLKVKDALFDAEDLLDEIQHEISKCQVEAEAEAESQTCTCKVPNFFKSSPVGSFNKEIKSRMEQVLEDLENLASQSGYLGLQNASGVGSGFGGAVSLHSESTSLVVESVIYGRDDDKEMIFNWLTSDIDNCNKLSILSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNRETVQGRLREKLTGNKFFLVLDDVWNRNQKEWKDLQTPLNYGASGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWRLFTKHAFRDDSHQPNPDFKEIGTKIVEKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEEDSSIVPALALSYHHLPSHLKRCFAYCALFPKDYRFDKEGLIQLWMAENFLQCHQQSRSPEKVGEQYFNDLLSRSLFQQSSTVERTPFVMHDLLNDLAKYVCGDICFRLENDQATNIPKTTRHFSVASDHVTCFDGFRTLYNAERLRTFMSLSEEMSFRNYNPWYCKMSTRELFSKFKFLRVLSLSGYYNLTKVPNSVGNLKYLSSLDLSHTEIVKLPESICSLYNLQILKLNGCEHLKELPSNLHKLTDLHRLELIDTEVRKVPAHLGKLKYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIRQLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDVIENLQPSKHLEKLTMSNYGGKQFPRWLFNNSLLRVVSLTLKNCKGFLCLPPLGRLPSLKELSIEGLDGIVSINADFFGSSSCSFTSLESLEFSDMKEWEEWECKGVTGAFPRLQRLSIMRCPKLKGHLPEQLCHLNYLKISGWDSLTTIPLDIFPILKELQIWECPNLQRISQGQALNHLETLSMRECPQLESLPEGMHVLLPSLDSLWIDDCPKVEMFPEGGLPSNLKSMGLYGGSYKLISLLKSALGGNHSLERLVIGGVDVECLPDEGVLPHSLVNLWIRECGDLKRLDYKGLCHLSSLKTLTLWDCPRLQCLPEEGLPKSISTLGILNCPLLKQRCREPEGEDWPKIAHIEEVFIWK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
9-976 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

ALLSAFLQVAFEKLASPQVLDFFRGRKLDEKLLNNLEIKLNSIQALADDAELKQFRDPPVRNWLLKVKDALFDAEDLLDEIQHEISKCQVEAEAEAESQTCTCKVPNFFKSSPVGSFNKEIKSRMEQVLEDLENLASQSGYLGLQNASGVGSGFGGAVSLHSESTSLVVESVIYGRDDDKEMIFNWLTSDIDNCNKLSILSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNRETVQGRLREKLTGNKFFLVLDDVWNRNQKEWKDLQTPLNYGASGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWRLFTKHAFRDDSHQPNPDFKEIGTKIVEKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEEDSSIVPALALSYHHLPSHLKRCFAYCALFPKDYRFDKEGLIQLWMAENFLQCHQQSRSPEKVGEQYFNDLLSRSLFQQSSTVERTPFVMHDLLNDLAKYVCGDICFRLENDQATNIPKTTRHFSVASDHVTCFDGFRTLYNAERLRTFMSLSEEMSFRNYNPWYCKMSTRELFSKFKFLRVLSLSGYYNLTKVPNSVGNLKYLSSLDLSHTEIVKLPESICSLYNLQILKLNGCEHLKELPSNLHKLTDLHRLELIDTEVRKVPAHLGKLKYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIRQLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDVIENLQPSKHLEKLTMSNYGGKQFPRWLFNNSLLRVVSLTLKNCKGFLCLPPLGRLPSLKELSIEGLDGIVSINADFFGSSSCSFTSLESLEFSDMKEWEEWECKGVTGAFPRLQRLSIMRCPKLKGHLPEQLCHLNYLKISGWDSLTTIPLDIFPILKELQIWECPNLQRISQGQALNHLETLSMRECPQLESLPEGMHVLLPSLDSLWIDDC

HMMPanther: PTHR23155
9-976 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ALLSAFLQVAFEKLASPQVLDFFRGRKLDEKLLNNLEIKLNSIQALADDAELKQFRDPPVRNWLLKVKDALFDAEDLLDEIQHEISKCQVEAEAEAESQTCTCKVPNFFKSSPVGSFNKEIKSRMEQVLEDLENLASQSGYLGLQNASGVGSGFGGAVSLHSESTSLVVESVIYGRDDDKEMIFNWLTSDIDNCNKLSILSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNRETVQGRLREKLTGNKFFLVLDDVWNRNQKEWKDLQTPLNYGASGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWRLFTKHAFRDDSHQPNPDFKEIGTKIVEKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEEDSSIVPALALSYHHLPSHLKRCFAYCALFPKDYRFDKEGLIQLWMAENFLQCHQQSRSPEKVGEQYFNDLLSRSLFQQSSTVERTPFVMHDLLNDLAKYVCGDICFRLENDQATNIPKTTRHFSVASDHVTCFDGFRTLYNAERLRTFMSLSEEMSFRNYNPWYCKMSTRELFSKFKFLRVLSLSGYYNLTKVPNSVGNLKYLSSLDLSHTEIVKLPESICSLYNLQILKLNGCEHLKELPSNLHKLTDLHRLELIDTEVRKVPAHLGKLKYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIRQLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDVIENLQPSKHLEKLTMSNYGGKQFPRWLFNNSLLRVVSLTLKNCKGFLCLPPLGRLPSLKELSIEGLDGIVSINADFFGSSSCSFTSLESLEFSDMKEWEEWECKGVTGAFPRLQRLSIMRCPKLKGHLPEQLCHLNYLKISGWDSLTTIPLDIFPILKELQIWECPNLQRISQGQALNHLETLSMRECPQLESLPEGMHVLLPSLDSLWIDDC

superfamily: SSF52540
174-414 SSF52540

SLVVESVIYGRDDDKEMIFNWLTSDIDNCNKLSILSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNRETVQGRLREKLTGNKFFLVLDDVWNRNQKEWKDLQTPLNYGASGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWRLFTKHAFRDDSHQPNPDFKEIGTKIVEKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEE

Gene3D: G3DSA:3.40.50.300
183-328 G3DSA:3.40.50.300

GRDDDKEMIFNWLTSDIDNCNKLSILSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNRETVQGRLREKLTGNKFFLVLDDVWNRNQKEWKDLQTPLNYGASGSKIVVTTRDKKVAS

HMMPfam: PF00931
IPR002182
185-467 NB-ARC,NBS
NB-ARC

DDDKEMIFNWLTSDIDNCNKLSILSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNRETVQGRLREKLTGNKFFLVLDDVWNRNQKEWKDLQTPLNYGASGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWRLFTKHAFRDDSHQPNPDFKEIGTKIVEKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEEDSSIVPALALSYHHLPSHLKRCFAYCALFPKDYRFDKEGLIQLWMAENFLQCH

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

ILSIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
280-294 DISEASERSIST
Disease resistance protein

KLTGNKFFLVLDDVW

FPrintScan: PR00364
IPR000767
377-391 DISEASERSIST
Disease resistance protein

CKGLPLALTTIGSLL

superfamily: SSF52058
502-929 SSF52058,LRR

VMHDLLNDLAKYVCGDICFRLENDQATNIPKTTRHFSVASDHVTCFDGFRTLYNAERLRTFMSLSEEMSFRNYNPWYCKMSTRELFSKFKFLRVLSLSGYYNLTKVPNSVGNLKYLSSLDLSHTEIVKLPESICSLYNLQILKLNGCEHLKELPSNLHKLTDLHRLELIDTEVRKVPAHLGKLKYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIRQLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDVIENLQPSKHLEKLTMSNYGGKQFPRWLFNNSLLRVVSLTLKNCKGFLCLPPLGRLPSLKELSIEGLDGIVSINADFFGSSSCSFTSLESLEFSDMKEWEEWECKGVTGAFPRLQRLSIMRCPKLKGHLPEQLCHLNYLKISGWDSLTTIPLDIFPILKELQIWECP

Gene3D: G3DSA:3.80.10.10
578-714 G3DSA:3.80.10.10

YCKMSTRELFSKFKFLRVLSLSGYYNLTKVPNSVGNLKYLSSLDLSHTEIVKLPESICSLYNLQILKLNGCEHLKELPSNLHKLTDLHRLELIDTEVRKVPAHLGKLKYLQVLMSSFNVGKSREFSIQQLGELNLHG

FPrintScan: PR00364
IPR000767
612-628 DISEASERSIST
Disease resistance protein

GNLKYLSSLDLSHTEIV

HMMPfam: PF00560
IPR001611
639-661 LRR_1
Leucine-rich repeat

NLQILKLNGCEHLKELPSNLHKL

Gene3D: G3DSA:3.80.10.10
773-972 G3DSA:3.80.10.10

LEKLTMSNYGGKQFPRWLFNNSLLRVVSLTLKNCKGFLCLPPLGRLPSLKELSIEGLDGIVSINADFFGSSSCSFTSLESLEFSDMKEWEEWECKGVTGAFPRLQRLSIMRCPKLKGHLPEQLCHLNYLKISGWDSLTTIPLDIFPILKELQIWECPNLQRISQGQALNHLETLSMRECPQLESLPEGMHVLLPSLDSLW

superfamily: SSF52058
908-1116 SSF52058,LRR

SLTTIPLDIFPILKELQIWECPNLQRISQGQALNHLETLSMRECPQLESLPEGMHVLLPSLDSLWIDDCPKVEMFPEGGLPSNLKSMGLYGGSYKLISLLKSALGGNHSLERLVIGGVDVECLPDEGVLPHSLVNLWIRECGDLKRLDYKGLCHLSSLKTLTLWDCPRLQCLPEEGLPKSISTLGILNCPLLKQRCREPEGEDWPKIAH

Gene3D: G3DSA:3.80.10.10
973-1099 G3DSA:3.80.10.10

IDDCPKVEMFPEGGLPSNLKSMGLYGGSYKLISLLKSALGGNHSLERLVIGGVDVECLPDEGVLPHSLVNLWIRECGDLKRLDYKGLCHLSSLKTLTLWDCPRLQCLPEEGLPKSISTLGILNCPLL


List of References

Tom Ashfield, Laura E Ong, Kan Nobuta, Christopher M Schneider, Roger W Innes
Convergent evolution of disease resistance gene specificity in two flowering plant families.
Plant Cell: 2004, 16(2);309-18
PubMed:14742871 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox