PRGDB00047484 (NBS-LRR type disease resistance protein RPG1-B)

From PRG Wiki
Jump to: navigation, search
NBS-LRR type disease resistance protein RPG1-B
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 38373620 (AY452684)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Glycine max

Comment?

Glycine max cultivar PS 16 NBS-LRR type disease resistance protein RPG1-B gene, complete cds.

DNA Sequence

ATGGCACTAGAATTGGTTGGTGGTGCTCTTCTTTCTGCTTTCCTTCAGGTTGCGTTTGAGAAGCTTGCTTCTCCTCAAGTTCTGGACTTCTTTCGTGGAAGAAAGCTTGATCAAAAGCTGCTCAACAACTTGGAAATCAAGCTGAACTCCATACAGGCTCTGGCTAATGATGCAGAACTAAAGCAGTTCAGAGATCCACTTGTCAGAAACTGGCTTCTTAAGGTCAAAGATGCTGTGTTTGACGCAGAGGATATCTTGGATGAAATACAACATGAGATCTCCAAATGCCAGGTCGAAGCTGAAGCTGAAGCTGAGTCTCAAACCTGCACTTGCAAGGTACCAAATTTCTTCAAATCTTCTCCTGCTAGTTCCTTTAACAGGGAAATTAAATCCAGGATGGAAGAAATCCTTGATAGATTAGATCTTCTCTCAAGCCAAAAGGATGATCTAGGCTTGAAAAATTCTAGTGGTGTTGGCGTTGGATCAGAATTGGGTAGTGCAGTACCACAGATATCACAATCAACATCTTCAGTTGTTGAAAGTGATATTTATGGCAGAGATAAAGACAAAAAAATGATTTTTGATTGGCTGACATCTGACAATGGCAATCCTAACCAGCCATCGATACTTTCTATTGTGGGCATGGGTGGGATGGGTAAGACCACACTTGCTCAACATGTATTCAATGACCCTAGGATCGAGGAGGCTAGATTTGATGTCAAAGCTTGGGTCTGTGTTTCAGATGATTTTGATGCTTTCAGGGTAACAAGAACAATTCTTGAGGCCATCACTAAATCGACTGATGATAGTAGAGACCTAGAGATGGTTCACGGAAGATTGAAAGAAAAATTGACGGGGAAGAGATTTCTTCTTGTTTTGGATGACGTTTGGAACGAAAACCGACTTAAATGGGAAGCTGTGCTAAAACATCTTGGTTTTGGGGCTCAGGGGAGTAGAATTATTGCCACCACACGTAGTAAGGAAGTTGCTTCTACCATGAGGTCAAAAGAACACCTCCTGGAGCAATTACAAGAAGATCATTGCTGGAAGTTGTTTGCTAAACATGCATTCCAAGATGATAATATTCAACCAAATCCAGATTGCAAGGAGATTGGTATGAAGATAGTTGAAAAATGTAAAGGACTTCCTCTGGCCTTGAAAACAATGGGAAGTCTATTACACAACAAGTCATCTGTTACGGAATGGAAAAGCATATTGCAGAGCGAGATATGGGAATTTTCAACAGAGCGTAGTGATATTGTACCTGCTTTAGCACTAAGCTATCACCATCTTCCTTCTCATCTCAAGAGATGTTTTGCTTATTGTGCCTTATTCCCCAAAGATTATGAGTTTGATAAGGAGTGCTTAATACAATTGTGGATGGCTGAAAAATTTCTACAATGTTCTCAACAGGGTAAGAGTCCAGGAGAAGTTGGTGAACAATACTTCAATGATCTATTATCAAGGTGCTTCTTTCAACAATCAAGCAACACAGAGAGAACAGATTTTGTCATGCATGACCTTCTCAACGATTTGGCAAGATTTATTTGTGGGGACATTTGTTTCAGATTGGATGGGAATCAAACAAAAGGTACACCAAAAGCAACCCGTCATTTTTTAATTGACGTTAAATGTTTTGATGGGTTTGGAACTCTATGTGACACAAAAAAGTTACGTACTTATATGCCAACAAGTTACAAATATTGGGATTGCGAGATGTCAATACACGAATTGTTCTCCAAGTTTAATTACTTACGTGTCTTATCTCTGTTTGATTGTCATGACCTAAGAGAGGTGCCTGACTCTGTGGGTAATCTCAAATATCTCCGTTCGTTAGACTTATCCAATACTAAAATAGAAAAACTACCTGAATCAATATGTTCACTCTACAACTTGCAAATACTGAAGCTAAATGGTTGTAGACATTTGAAGGAGCTGCCCTCAAATTTGCATAAACTCACTGATTTGCATCGGCTTGAATTAATAGAAACTGGAGTGAGAAAGGTACCAGCACATTTGGGAAAACTGGAGTATCTTCAAGTATTAATGAGTTCGTTTAATGTTGGCAAAAGTAGGGAGTTCAGTATCCAGCAGTTAGGAGAACTCAATCTTCATGGAAGTCTATCAATAAGGCAACTGCAGAATGTTGAGAATCCATCAGATGCATTAGCGGTGGATTTAAAAAATAAAACACACCTTGTCGAGCTAGAGTTAGAATGGGATTCAGACTGGAACCCTGATGATTCAACAAAAGAAAGGGATGTAATCGAGAATCTACAGCCTTCCAAACACTTGGAGAAGTTGAGGATGAGGAACTATGGGGGTACTCAATTTCCAAGGTGGTTATTCAACAATTCATCATGTAGTGTGGTGTCCTTAACCTTGAAGAACTGTAAATATTGCCTATGTTTGCCTCCCCTTGGACTTTTGCCATCTCTGAAGGAACTTTCAATTAAAGGGCTTGATGGGATCGTGAGTATCAATGCTGATTTTTTCGGGAGTAGCTCTTGTTCATTTACATCCTTGAAATCTTTGGAGTTCTACCATATGAAGGAATGGGAAGAATGGGAATGTAAAGGTGTGACAGGTGCTTTTCCACGTCTTCAACGTCTTTCTATAGAGCGTTGTCCCAAGCTGAAAGGGCACTTGCCAGAGCAACTATGTCATTTAAATTCTCTAAAGATTTCTGGGTGTGAACAACTTGTACCTTCTGCTCTCAGTGCCCCTGATATTCATAAATTATACCTAGGAGACTGTGGAGAGCTGCAAATTGATCATGGGACAACTTTGAAAGAGCTTACCATTGAAGGTCACAACGTGGAGGCAGCCTTATTCGAAGAGATTGGGCGCAATTACTCTTGTTCAAATAACAATATTCCCATGCACAGTTGCTATGATTTCCTTGTAAGCTTGCGCATCAAAGGTGGCTGCGACTCTTTAACGACCTTTCCGCTAGATATGTTCACAATACTCAGGGAACTTTGTATCTGGAAGTGTCCTAATCTACGGAGGATTTCACAAGGGCAGGCTCATAATCATCTCCAGACTCTGGATATCAAAGAGTGCCCCCAATTAGAATCATTGCCTGAAGGAATGCATGTCCTCCTTCCATCTCTTGATTCTCTGTGCATAGATGATTGTCCAAAAGTTGAAATGTTTCCCGAAGGAGGTTTGCCATCAAATTTAAAAGAAATGGGTCTCTTTGGTGGTAGTTACAAACTTATGTCCTTATTGAAAAGTGCCTTGGGAGGCAATCACTCTCTAGAACGGTTAGTTATTGGAAAAGTGGATTTTGAGTGTCTTCCTGAGGAAGGTGTACTGCCACACTCTCTTGTTTCTCTACAGATCAATAGCTGTGGAGATCTTAAAAGACTGGACTACAAAGGTATCTGCCACCTCTCCTCTCTCAAGGAATTGAGTCTTGAAGACTGCCCCAGGCTCCAATGCTTACCAGAGGAGGGTCTGCCCAAATCCATTTCATCTTTGTGGATTTGGGGGGACTGTCAGTTGCTCAAAGAACGTTGCCGGGAACCCGAAGGCGAAGACTGGCCAAAGATTGCTCACTTTTGCCCGTTGCTCAATCAACGTTGCCGGGAACCCGGAGGCGAAGACTGGCCAAAGATTGCTGACATTGAAAACGTGTATATAAGGTAG


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein RPG1-B NBS-LRR type disease resistance protein RPG1-B [Glycine max].

MALELVGGALLSAFLQVAFEKLASPQVLDFFRGRKLDQKLLNNLEIKLNSIQALANDAELKQFRDPLVRNWLLKVKDAVFDAEDILDEIQHEISKCQVEAEAEAESQTCTCKVPNFFKSSPASSFNREIKSRMEEILDRLDLLSSQKDDLGLKNSSGVGVGSELGSAVPQISQSTSSVVESDIYGRDKDKKMIFDWLTSDNGNPNQPSILSIVGMGGMGKTTLAQHVFNDPRIEEARFDVKAWVCVSDDFDAFRVTRTILEAITKSTDDSRDLEMVHGRLKEKLTGKRFLLVLDDVWNENRLKWEAVLKHLGFGAQGSRIIATTRSKEVASTMRSKEHLLEQLQEDHCWKLFAKHAFQDDNIQPNPDCKEIGMKIVEKCKGLPLALKTMGSLLHNKSSVTEWKSILQSEIWEFSTERSDIVPALALSYHHLPSHLKRCFAYCALFPKDYEFDKECLIQLWMAEKFLQCSQQGKSPGEVGEQYFNDLLSRCFFQQSSNTERTDFVMHDLLNDLARFICGDICFRLDGNQTKGTPKATRHFLIDVKCFDGFGTLCDTKKLRTYMPTSYKYWDCEMSIHELFSKFNYLRVLSLFDCHDLREVPDSVGNLKYLRSLDLSNTKIEKLPESICSLYNLQILKLNGCRHLKELPSNLHKLTDLHRLELIETGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIRQLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDVIENLQPSKHLEKLRMRNYGGTQFPRWLFNNSSCSVVSLTLKNCKYCLCLPPLGLLPSLKELSIKGLDGIVSINADFFGSSSCSFTSLKSLEFYHMKEWEEWECKGVTGAFPRLQRLSIERCPKLKGHLPEQLCHLNSLKISGCEQLVPSALSAPDIHKLYLGDCGELQIDHGTTLKELTIEGHNVEAALFEEIGRNYSCSNNNIPMHSCYDFLVSLRIKGGCDSLTTFPLDMFTILRELCIWKCPNLRRISQGQAHNHLQTLDIKECPQLESLPEGMHVLLPSLDSLCIDDCPKVEMFPEGGLPSNLKEMGLFGGSYKLMSLLKSALGGNHSLERLVIGKVDFECLPEEGVLPHSLVSLQINSCGDLKRLDYKGICHLSSLKELSLEDCPRLQCLPEEGLPKSISSLWIWGDCQLLKERCREPEGEDWPKIAHFCPLLNQRCREPGGEDWPKIADIENVYIR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
6-901 PTHR23155:SF121,SUBFAMILY NOT NAMED

VGGALLSAFLQVAFEKLASPQVLDFFRGRKLDQKLLNNLEIKLNSIQALANDAELKQFRDPLVRNWLLKVKDAVFDAEDILDEIQHEISKCQVEAEAEAESQTCTCKVPNFFKSSPASSFNREIKSRMEEILDRLDLLSSQKDDLGLKNSSGVGVGSELGSAVPQISQSTSSVVESDIYGRDKDKKMIFDWLTSDNGNPNQPSILSIVGMGGMGKTTLAQHVFNDPRIEEARFDVKAWVCVSDDFDAFRVTRTILEAITKSTDDSRDLEMVHGRLKEKLTGKRFLLVLDDVWNENRLKWEAVLKHLGFGAQGSRIIATTRSKEVASTMRSKEHLLEQLQEDHCWKLFAKHAFQDDNIQPNPDCKEIGMKIVEKCKGLPLALKTMGSLLHNKSSVTEWKSILQSEIWEFSTERSDIVPALALSYHHLPSHLKRCFAYCALFPKDYEFDKECLIQLWMAEKFLQCSQQGKSPGEVGEQYFNDLLSRCFFQQSSNTERTDFVMHDLLNDLARFICGDICFRLDGNQTKGTPKATRHFLIDVKCFDGFGTLCDTKKLRTYMPTSYKYWDCEMSIHELFSKFNYLRVLSLFDCHDLREVPDSVGNLKYLRSLDLSNTKIEKLPESICSLYNLQILKLNGCRHLKELPSNLHKLTDLHRLELIETGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIRQLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDVIENLQPSKHLEKLRMRNYGGTQFPRWLFNNSSCSVVSLTLKNCKYCLCLPPLGLLPSLKELSIKGLDGIVSINADFFGSSSCSFTSLKSLEFYHMKEWEEWECKGVTGAFPRLQRLSIERCPKLKGHLPEQLCHLNSLKISGCEQL

HMMPanther: PTHR23155
6-901 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VGGALLSAFLQVAFEKLASPQVLDFFRGRKLDQKLLNNLEIKLNSIQALANDAELKQFRDPLVRNWLLKVKDAVFDAEDILDEIQHEISKCQVEAEAEAESQTCTCKVPNFFKSSPASSFNREIKSRMEEILDRLDLLSSQKDDLGLKNSSGVGVGSELGSAVPQISQSTSSVVESDIYGRDKDKKMIFDWLTSDNGNPNQPSILSIVGMGGMGKTTLAQHVFNDPRIEEARFDVKAWVCVSDDFDAFRVTRTILEAITKSTDDSRDLEMVHGRLKEKLTGKRFLLVLDDVWNENRLKWEAVLKHLGFGAQGSRIIATTRSKEVASTMRSKEHLLEQLQEDHCWKLFAKHAFQDDNIQPNPDCKEIGMKIVEKCKGLPLALKTMGSLLHNKSSVTEWKSILQSEIWEFSTERSDIVPALALSYHHLPSHLKRCFAYCALFPKDYEFDKECLIQLWMAEKFLQCSQQGKSPGEVGEQYFNDLLSRCFFQQSSNTERTDFVMHDLLNDLARFICGDICFRLDGNQTKGTPKATRHFLIDVKCFDGFGTLCDTKKLRTYMPTSYKYWDCEMSIHELFSKFNYLRVLSLFDCHDLREVPDSVGNLKYLRSLDLSNTKIEKLPESICSLYNLQILKLNGCRHLKELPSNLHKLTDLHRLELIETGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIRQLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDVIENLQPSKHLEKLRMRNYGGTQFPRWLFNNSSCSVVSLTLKNCKYCLCLPPLGLLPSLKELSIKGLDGIVSINADFFGSSSCSFTSLKSLEFYHMKEWEEWECKGVTGAFPRLQRLSIERCPKLKGHLPEQLCHLNSLKISGCEQL

ProfileScan: PS51450
IPR001611
40-61 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLNNLEIKLNSIQALANDAELK

superfamily: SSF52540
166-416 SSF52540

SAVPQISQSTSSVVESDIYGRDKDKKMIFDWLTSDNGNPNQPSILSIVGMGGMGKTTLAQHVFNDPRIEEARFDVKAWVCVSDDFDAFRVTRTILEAITKSTDDSRDLEMVHGRLKEKLTGKRFLLVLDDVWNENRLKWEAVLKHLGFGAQGSRIIATTRSKEVASTMRSKEHLLEQLQEDHCWKLFAKHAFQDDNIQPNPDCKEIGMKIVEKCKGLPLALKTMGSLLHNKSSVTEWKSILQSEIWEFSTE

Gene3D: G3DSA:3.40.50.300
180-326 G3DSA:3.40.50.300

ESDIYGRDKDKKMIFDWLTSDNGNPNQPSILSIVGMGGMGKTTLAQHVFNDPRIEEARFDVKAWVCVSDDFDAFRVTRTILEAITKSTDDSRDLEMVHGRLKEKLTGKRFLLVLDDVWNENRLKWEAVLKHLGFGAQGSRIIATTRS

HMMPfam: PF00931
IPR002182
187-470 NB-ARC,NBS
NB-ARC

DKDKKMIFDWLTSDNGNPNQPSILSIVGMGGMGKTTLAQHVFNDPRIEEARFDVKAWVCVSDDFDAFRVTRTILEAITKSTDDSRDLEMVHGRLKEKLTGKRFLLVLDDVWNENRLKWEAVLKHLGFGAQGSRIIATTRSKEVASTMRSKEHLLEQLQEDHCWKLFAKHAFQDDNIQPNPDCKEIGMKIVEKCKGLPLALKTMGSLLHNKSSVTEWKSILQSEIWEFSTERSDIVPALALSYHHLPSHLKRCFAYCALFPKDYEFDKECLIQLWMAEKFLQCSQ

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

ILSIVGMGGMGKTTLA

FPrintScan: PR00364
IPR000767
283-297 DISEASERSIST
Disease resistance protein

KLTGKRFLLVLDDVW

FPrintScan: PR00364
IPR000767
379-393 DISEASERSIST
Disease resistance protein

CKGLPLALKTMGSLL

superfamily: SSF52058
504-895 SSF52058,LRR

VMHDLLNDLARFICGDICFRLDGNQTKGTPKATRHFLIDVKCFDGFGTLCDTKKLRTYMPTSYKYWDCEMSIHELFSKFNYLRVLSLFDCHDLREVPDSVGNLKYLRSLDLSNTKIEKLPESICSLYNLQILKLNGCRHLKELPSNLHKLTDLHRLELIETGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIRQLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDVIENLQPSKHLEKLRMRNYGGTQFPRWLFNNSSCSVVSLTLKNCKYCLCLPPLGLLPSLKELSIKGLDGIVSINADFFGSSSCSFTSLKSLEFYHMKEWEEWECKGVTGAFPRLQRLSIERCPKLKGHLPEQLCHLNSLKI

Gene3D: G3DSA:3.80.10.10
576-706 G3DSA:3.80.10.10

HELFSKFNYLRVLSLFDCHDLREVPDSVGNLKYLRSLDLSNTKIEKLPESICSLYNLQILKLNGCRHLKELPSNLHKLTDLHRLELIETGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHG

FPrintScan: PR00364
IPR000767
604-620 DISEASERSIST
Disease resistance protein

GNLKYLRSLDLSNTKIE

ProfileScan: PS51450
IPR001611
608-629 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLRSLDLSNTKIEKLPESICSL

HMMPfam: PF00560
IPR001611
609-629 LRR_1
Leucine-rich repeat

LRSLDLSNTKIEKLPESICSL

HMMPfam: PF00560
IPR001611
631-653 LRR_1
Leucine-rich repeat

NLQILKLNGCRHLKELPSNLHKL

ProfileScan: PS51450
IPR001611
631-654 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQILKLNGCRHLKELPSNLHKLT

Gene3D: G3DSA:3.80.10.10
726-960 G3DSA:3.80.10.10

DLKNKTHLVELELEWDSDWNPDDSTKERDVIENLQPSKHLEKLRMRNYGGTQFPRWLFNNSSCSVVSLTLKNCKYCLCLPPLGLLPSLKELSIKGLDGIVSINADFFGSSSCSFTSLKSLEFYHMKEWEEWECKGVTGAFPRLQRLSIERCPKLKGHLPEQLCHLNSLKISGCEQLVPSALSAPDIHKLYLGDCGELQIDHGTTLKELTIEGHNVEAALFEEIGRNYSCSNNNIP

superfamily: SSF52058
953-1188 SSF52058,LRR

SCSNNNIPMHSCYDFLVSLRIKGGCDSLTTFPLDMFTILRELCIWKCPNLRRISQGQAHNHLQTLDIKECPQLESLPEGMHVLLPSLDSLCIDDCPKVEMFPEGGLPSNLKEMGLFGGSYKLMSLLKSALGGNHSLERLVIGKVDFECLPEEGVLPHSLVSLQINSCGDLKRLDYKGICHLSSLKELSLEDCPRLQCLPEEGLPKSISSLWIWGDCQLLKERCREPEGEDWPKIAH

Gene3D: G3DSA:3.80.10.10
1000-1163 G3DSA:3.80.10.10

PNLRRISQGQAHNHLQTLDIKECPQLESLPEGMHVLLPSLDSLCIDDCPKVEMFPEGGLPSNLKEMGLFGGSYKLMSLLKSALGGNHSLERLVIGKVDFECLPEEGVLPHSLVSLQINSCGDLKRLDYKGICHLSSLKELSLEDCPRLQCLPEEGLPKSISSLW


List of References

Tom Ashfield, Laura E Ong, Kan Nobuta, Christopher M Schneider, Roger W Innes
Convergent evolution of disease resistance gene specificity in two flowering plant families.
Plant Cell: 2004, 16(2);309-18
PubMed:14742871 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox