PRGDB00047485 (OSJNBa0095N06.28)

From PRG Wiki
Jump to: navigation, search
OSJNBa0095N06.28
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 34447242 (AC093312)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 3 BAC OSJNBa0095N06 genomic sequence, complete sequence.

DNA Sequence

ATGCCATCGACGTTCGGATGGTCGGCGTCGGCGTTCGTCGCGGCCGTGCTCGCCCGCCTCATCGGCAAGGGCCTCGCGCTGCTCGCGGAGCTCGACGACGCCGCGGCAGGCCACCTCCGGCGCCTCGAGGCCCTCCTCGCCCCCGTCTGGCGTGTCCTCGACGCCGCCGACGCCGGCGCCATCGACGTTGTCGGCCACCGGCGCCCTCTTCAGGACCTTCTCGACGCCGCGTATGCCGCTGACGACGCCCTCGACGACCTCGTGCTGCTCCAGTCCGACGCGATGGCGAGAGGCGGGGAGCACGGTGTCGACGCCCGCGGGACGCCCGCCGCCGGCGCGGCGAGGAAGCCCAAGCCGTGCAGCCCGCTCAGGTTCCTGCTCTGCTTCAGCCCACCCAGAAATGCCGTTGCTAGCAGCAGCAGCAGCAGCAGCGGCAGCCATGGCAAAAGCTCAAAGGGGAACAAGAGTAATCCTGACCTGCGTGGCTTAGGAGTTGCGTTTGAGATGATGGCACAAGCTGCGTACAGGTGCACGTCGGCGTACGAGCACGTCGTGGCAGGGAAGAACTACGCCACGATGGTTTCAGCACAAGCAGAGGCTGCAACAGCAGCGGAAGCAGCTGATTATGATCAGTTTCAGAATGACATATTTGGGAGGGAAACTGAGGTGGAGCAGATCTTGGAGAAGGTGAGGTTCAGCGACGACCCGCATTACCGGCTAGGGATCGGTGTTCTCCCAATCGTCGGCGTCGAGGGGGTGGGCAAGACGGCGCTCGCGCAGTTCATCTTCCACTACGAGGTCGTCAAGGCCGAGTTCCCCGTGCGGATGTGGGTGCACGTCTCCGGCGAGGTCCAGCTCAAGGACGAACTCGTGGTCCAGATGATCCATGGTGTTGCCGGAGATGCCCATGAAGTCGAAGACATCAGGGAGATCCTTCACGAGGAGTTGACCGGCAAGAGGTTCCTGCTTGTTCTTGACGATGTTAGCGATGTCGGCGACATCCAGTGGAAAGATCTAATGAGGCTTCTGCAACCTGCAGCCAGGAGGAGCATGATCATGGTGACAACTCAATCTGAAATTGCAGCAAATGCGATAGGAACAATGCCTCCATTAATACTGAATCCATTGGAATCTGAGGATTACCAGAAGATGTTCAGACACTTCGCATTTGGCAGCTCTGATGAGTCTGAAGATTACACTCCACTGGGAGACGAATGGGACGACGTTGAAGACGAAGACGAGGAAGAGAAGCAGTCACCGATGGAGAAGGTTGCATTGGAGCTAGCCAAGAAGATGGGCGGCCTACCATTACCAGCGACGGCGATTGCACGGGCTCTGTTTTTCCGCCGGGAAGACAAGGAGCACTGGAAAAACGTGCTGGAAGACAAGCTCTGGGAGCAGCGAGACGTCGCCGGCATCTCGCCGGCGCTGTGGCTGAGCTACCAACACCTCGATCCTCGCCTCAAGCAATGCTTCGCATATTCTGCAGTGTTTCCATGTAGCCATGCCTTCACAAAGGATGAACTGGTTCAGATGTGGGTAGCACAGGGGCTGATATATTCTGAAGATGCCGTGGCGAGGCCTGAGGACATTGGAAGCAAGTTCTTTGAAGATTTGGTTGAAAGATGCTTCTTTCAGCCAATTGGAAGCAGCAGATATGTGGTACACAATTCGATGCGAAAACTAGCACAGGCAGTCTCAACAGATCAGTTCTTCATGGTCACCGAGAGCTCAGGAGACGTGCCACTAGAAGTTCGTCACCTGACCATCATGACAAACAACCTCTCCAAGCTGATAAATGATCTGTCATTGAAGATATCTCATTCATCTGGATCTGACCAACACTTCCTCCAACGGATTCGTACAATTATTTTCTTTGCAGATTTCAGTAATTCAGATGAATTTATCGAATTTCTCGCTGATATTTTCAAGGTAGCAAAAGATGTGAGAGTTCTTGGTGTGACATATGCAAATATAGCATTTTTGCCTGCTGAGATTGGCTTTCTCCGACACCTCCGGTATCTGAATCTGCTCGGGAACAGAATAGCAGATCTTCCTGAGTCAGTTTGTGATCTCCACCTCCTCCAGGTTCTGGATGTGCGCTGCAGTTCTCCTTATCTCCGTGCTCCCAATGGCATCACCAATCTGATTTATCTGAGGCATTTGCATGCAAGTGAGCCTTTTCTTTCTATCATACCAAAAATACAGAATCTCTCACATTTGCAAGAATTGGAGGTGTACAAAGTTAGCAGTATTTCGCGCATCGACGCCTTACAAGGGATGACACAACTCCGAGGTACACTTTGTCTTAAAGATCTCCATCAGGTTGATGTTAGTGAGCTAAGGAAGGGCATCTTGAAGGGTATGCAACATCTGAACATATTAGAGTTGTCATGGAGCAGCTCTGATAGCCAAAGCAGAGAGGCTTCCACAGATGAAGACACACTTGAGTGCTTGCAACCACATGAGAACCTGAAAGATCTGAGAATTACAGGCTACAGAAGCACTAAATGCCCATCATGGATGCTAAAGACTCCTTGTTCTCTATCAAATGCTACTTCAGTTTTCTTAACGGATTGCGTGAACCTGAAGAATCTCCCTCCATTCCATATCATGCCCTGCCTTGAGATTCTCGAGATGAGAAAAATCCATTCTGTCAACAAGGTGAACACTGTTCCTCAACGATCAGATCAGATCATGTTCCCAAAGCTCAAACGCCTTGTTTTCGAAGATGTGTTGAACTGTACTGAATGGTCGACAGGCAGCTCAAAATCAAGAAACACCGTATTTCCCTGCCTCTGTGAAATCCAGATAAGGAACTGCCCAAAGCTGAGAAACTTTCCTGACCTTCCACTTACACTGACAACAATGATCATTGAGAATGTTGGTCTTGAAACACTACCAAGGATACAGGACAGACATTCATTACCACCATCATCATCATCAGATGCGATTGCAACATCGAAAGAAGGCAGATGGACATCAAGGCTCACAACACTACAAATACATCAGTGTCACGGGCTGAAATCTCTAGGATCAAGCCTGCTTCAGCAGCAGCACCTCCTAAGGTCCCTCGAGGTCTTGTCAATAAAGAACTGCGACAACGTTACGTGTGATCTCTCTGACGGTTTTCAGGACCTCACTGCATTGACAGACCTATCACTATACGATTGCCCGAAGCTTCTAGTCGACAAGTTCCACACATCGCTGCGAAAGCTAGAGATCAGCGAATGCTTCATCACACATGGGGCATGGGTGGATGACTACCCCTTCCTGTTCTCAGTGTGGACACTAAAGGTTACCAGTTGTCCTCATGTTAGCACTGATCAGGAAAGCAGCTTCAGCATCGAACCTCTGGATTGGTTGAACTGCCTGTTCAATGTGTGCAGTCTTCACCTGGAGAACACATTGCTTCTGAAACTGAGCATGTTTAACAGGCTTCGCTCTCTTGAGATCCTAGAGATCGACGGGAGTCGCTCATTCTTCGATGATTTGGTAGAGGAATTTGAGTGGCTGGAGAAGCTGCAGGCTCTGAGCATTAGAAACTGCAAGGAATTGAGAATGCTTCCAGCGAATATCTCTACTCTGCCTGTGTTGGAAGAACTCTGCATAGAAAACTGTCCAGCTTTGGAGGCGTTGCCTGCGAGTGGTCTGCCTACTTCGCTGAAGAGATTGTCAATATCGAAATGCAGTCCACGGTTAACTCAACGATGTCTTGATGATGAACCTGATAATCTGAATATTGCAAAGATTGCTGTTGTTTACATTGATGGGCAATGTATTAGTATTCAACAAAAATAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MPSTFGWSASAFVAAVLARLIGKGLALLAELDDAAAGHLRRLEALLAPVWRVLDAADAGAIDVVGHRRPLQDLLDAAYAADDALDDLVLLQSDAMARGGEHGVDARGTPAAGAARKPKPCSPLRFLLCFSPPRNAVASSSSSSSGSHGKSSKGNKSNPDLRGLGVAFEMMAQAAYRCTSAYEHVVAGKNYATMVSAQAEAATAAEAADYDQFQNDIFGRETEVEQILEKVRFSDDPHYRLGIGVLPIVGVEGVGKTALAQFIFHYEVVKAEFPVRMWVHVSGEVQLKDELVVQMIHGVAGDAHEVEDIREILHEELTGKRFLLVLDDVSDVGDIQWKDLMRLLQPAARRSMIMVTTQSEIAANAIGTMPPLILNPLESEDYQKMFRHFAFGSSDESEDYTPLGDEWDDVEDEDEEEKQSPMEKVALELAKKMGGLPLPATAIARALFFRREDKEHWKNVLEDKLWEQRDVAGISPALWLSYQHLDPRLKQCFAYSAVFPCSHAFTKDELVQMWVAQGLIYSEDAVARPEDIGSKFFEDLVERCFFQPIGSSRYVVHNSMRKLAQAVSTDQFFMVTESSGDVPLEVRHLTIMTNNLSKLINDLSLKISHSSGSDQHFLQRIRTIIFFADFSNSDEFIEFLADIFKVAKDVRVLGVTYANIAFLPAEIGFLRHLRYLNLLGNRIADLPESVCDLHLLQVLDVRCSSPYLRAPNGITNLIYLRHLHASEPFLSIIPKIQNLSHLQELEVYKVSSISRIDALQGMTQLRGTLCLKDLHQVDVSELRKGILKGMQHLNILELSWSSSDSQSREASTDEDTLECLQPHENLKDLRITGYRSTKCPSWMLKTPCSLSNATSVFLTDCVNLKNLPPFHIMPCLEILEMRKIHSVNKVNTVPQRSDQIMFPKLKRLVFEDVLNCTEWSTGSSKSRNTVFPCLCEIQIRNCPKLRNFPDLPLTLTTMIIENVGLETLPRIQDRHSLPPSSSSDAIATSKEGRWTSRLTTLQIHQCHGLKSLGSSLLQQQHLLRSLEVLSIKNCDNVTCDLSDGFQDLTALTDLSLYDCPKLLVDKFHTSLRKLEISECFITHGAWVDDYPFLFSVWTLKVTSCPHVSTDQESSFSIEPLDWLNCLFNVCSLHLENTLLLKLSMFNRLRSLEILEIDGSRSFFDDLVEEFEWLEKLQALSIRNCKELRMLPANISTLPVLEELCIENCPALEALPASGLPTSLKRLSISKCSPRLTQRCLDDEPDNLNIAKIAVVYIDGQCISIQQK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF137
72-1251 PTHR23155:SF137,OS03G0573500 PROTEIN

DLLDAAYAADDALDDLVLLQSDAMARGGEHGVDARGTPAAGAARKPKPCSPLRFLLCFSPPRNAVASSSSSSSGSHGKSSKGNKSNPDLRGLGVAFEMMAQAAYRCTSAYEHVVAGKNYATMVSAQAEAATAAEAADYDQFQNDIFGRETEVEQILEKVRFSDDPHYRLGIGVLPIVGVEGVGKTALAQFIFHYEVVKAEFPVRMWVHVSGEVQLKDELVVQMIHGVAGDAHEVEDIREILHEELTGKRFLLVLDDVSDVGDIQWKDLMRLLQPAARRSMIMVTTQSEIAANAIGTMPPLILNPLESEDYQKMFRHFAFGSSDESEDYTPLGDEWDDVEDEDEEEKQSPMEKVALELAKKMGGLPLPATAIARALFFRREDKEHWKNVLEDKLWEQRDVAGISPALWLSYQHLDPRLKQCFAYSAVFPCSHAFTKDELVQMWVAQGLIYSEDAVARPEDIGSKFFEDLVERCFFQPIGSSRYVVHNSMRKLAQAVSTDQFFMVTESSGDVPLEVRHLTIMTNNLSKLINDLSLKISHSSGSDQHFLQRIRTIIFFADFSNSDEFIEFLADIFKVAKDVRVLGVTYANIAFLPAEIGFLRHLRYLNLLGNRIADLPESVCDLHLLQVLDVRCSSPYLRAPNGITNLIYLRHLHASEPFLSIIPKIQNLSHLQELEVYKVSSISRIDALQGMTQLRGTLCLKDLHQVDVSELRKGILKGMQHLNILELSWSSSDSQSREASTDEDTLECLQPHENLKDLRITGYRSTKCPSWMLKTPCSLSNATSVFLTDCVNLKNLPPFHIMPCLEILEMRKIHSVNKVNTVPQRSDQIMFPKLKRLVFEDVLNCTEWSTGSSKSRNTVFPCLCEIQIRNCPKLRNFPDLPLTLTTMIIENVGLETLPRIQDRHSLPPSSSSDAIATSKEGRWTSRLTTLQIHQCHGLKSLGSSLLQQQHLLRSLEVLSIKNCDNVTCDLSDGFQDLTALTDLSLYDCPKLLVDKFHTSLRKLEISECFITHGAWVDDYPFLFSVWTLKVTSCPHVSTDQESSFSIEPLDWLNCLFNVCSLHLENTLLLKLSMFNRLRSLEILEIDGSRSFFDDLVEEFEWLEKLQALSIRNCKELRMLPANISTLPVLEELCIENCPALEALPASGLPTSLKRLSISKCSPRLTQRCLDDEPDNLNIAKI

HMMPanther: PTHR23155
72-1251 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DLLDAAYAADDALDDLVLLQSDAMARGGEHGVDARGTPAAGAARKPKPCSPLRFLLCFSPPRNAVASSSSSSSGSHGKSSKGNKSNPDLRGLGVAFEMMAQAAYRCTSAYEHVVAGKNYATMVSAQAEAATAAEAADYDQFQNDIFGRETEVEQILEKVRFSDDPHYRLGIGVLPIVGVEGVGKTALAQFIFHYEVVKAEFPVRMWVHVSGEVQLKDELVVQMIHGVAGDAHEVEDIREILHEELTGKRFLLVLDDVSDVGDIQWKDLMRLLQPAARRSMIMVTTQSEIAANAIGTMPPLILNPLESEDYQKMFRHFAFGSSDESEDYTPLGDEWDDVEDEDEEEKQSPMEKVALELAKKMGGLPLPATAIARALFFRREDKEHWKNVLEDKLWEQRDVAGISPALWLSYQHLDPRLKQCFAYSAVFPCSHAFTKDELVQMWVAQGLIYSEDAVARPEDIGSKFFEDLVERCFFQPIGSSRYVVHNSMRKLAQAVSTDQFFMVTESSGDVPLEVRHLTIMTNNLSKLINDLSLKISHSSGSDQHFLQRIRTIIFFADFSNSDEFIEFLADIFKVAKDVRVLGVTYANIAFLPAEIGFLRHLRYLNLLGNRIADLPESVCDLHLLQVLDVRCSSPYLRAPNGITNLIYLRHLHASEPFLSIIPKIQNLSHLQELEVYKVSSISRIDALQGMTQLRGTLCLKDLHQVDVSELRKGILKGMQHLNILELSWSSSDSQSREASTDEDTLECLQPHENLKDLRITGYRSTKCPSWMLKTPCSLSNATSVFLTDCVNLKNLPPFHIMPCLEILEMRKIHSVNKVNTVPQRSDQIMFPKLKRLVFEDVLNCTEWSTGSSKSRNTVFPCLCEIQIRNCPKLRNFPDLPLTLTTMIIENVGLETLPRIQDRHSLPPSSSSDAIATSKEGRWTSRLTTLQIHQCHGLKSLGSSLLQQQHLLRSLEVLSIKNCDNVTCDLSDGFQDLTALTDLSLYDCPKLLVDKFHTSLRKLEISECFITHGAWVDDYPFLFSVWTLKVTSCPHVSTDQESSFSIEPLDWLNCLFNVCSLHLENTLLLKLSMFNRLRSLEILEIDGSRSFFDDLVEEFEWLEKLQALSIRNCKELRMLPANISTLPVLEELCIENCPALEALPASGLPTSLKRLSISKCSPRLTQRCLDDEPDNLNIAKI

superfamily: SSF52540
199-469 SSF52540

EAATAAEAADYDQFQNDIFGRETEVEQILEKVRFSDDPHYRLGIGVLPIVGVEGVGKTALAQFIFHYEVVKAEFPVRMWVHVSGEVQLKDELVVQMIHGVAGDAHEVEDIREILHEELTGKRFLLVLDDVSDVGDIQWKDLMRLLQPAARRSMIMVTTQSEIAANAIGTMPPLILNPLESEDYQKMFRHFAFGSSDESEDYTPLGDEWDDVEDEDEEEKQSPMEKVALELAKKMGGLPLPATAIARALFFRREDKEHWKNVLEDKLWEQRD

Gene3D: G3DSA:3.40.50.300
214-348 G3DSA:3.40.50.300

NDIFGRETEVEQILEKVRFSDDPHYRLGIGVLPIVGVEGVGKTALAQFIFHYEVVKAEFPVRMWVHVSGEVQLKDELVVQMIHGVAGDAHEVEDIREILHEELTGKRFLLVLDDVSDVGDIQWKDLMRLLQPAAR

HMMPfam: PF00931
IPR002182
220-523 NB-ARC,NBS
NB-ARC

ETEVEQILEKVRFSDDPHYRLGIGVLPIVGVEGVGKTALAQFIFHYEVVKAEFPVRMWVHVSGEVQLKDELVVQMIHGVAGDAHEVEDIREILHEELTGKRFLLVLDDVSDVGDIQWKDLMRLLQPAARRSMIMVTTQSEIAANAIGTMPPLILNPLESEDYQKMFRHFAFGSSDESEDYTPLGDEWDDVEDEDEEEKQSPMEKVALELAKKMGGLPLPATAIARALFFRREDKEHWKNVLEDKLWEQRDVAGISPALWLSYQHLDPRLKQCFAYSAVFPCSHAFTKDELVQMWVAQGLIYSED

FPrintScan: PR00364
IPR000767
244-259 DISEASERSIST
Disease resistance protein

VLPIVGVEGVGKTALA

FPrintScan: PR00364
IPR000767
315-329 DISEASERSIST
Disease resistance protein

ELTGKRFLLVLDDVS

FPrintScan: PR00364
IPR000767
432-446 DISEASERSIST
Disease resistance protein

MGGLPLPATAIARAL

superfamily: SSF52058
558-953 SSF52058,LRR

SMRKLAQAVSTDQFFMVTESSGDVPLEVRHLTIMTNNLSKLINDLSLKISHSSGSDQHFLQRIRTIIFFADFSNSDEFIEFLADIFKVAKDVRVLGVTYANIAFLPAEIGFLRHLRYLNLLGNRIADLPESVCDLHLLQVLDVRCSSPYLRAPNGITNLIYLRHLHASEPFLSIIPKIQNLSHLQELEVYKVSSISRIDALQGMTQLRGTLCLKDLHQVDVSELRKGILKGMQHLNILELSWSSSDSQSREASTDEDTLECLQPHENLKDLRITGYRSTKCPSWMLKTPCSLSNATSVFLTDCVNLKNLPPFHIMPCLEILEMRKIHSVNKVNTVPQRSDQIMFPKLKRLVFEDVLNCTEWSTGSSKSRNTVFPCLCEIQIRNCPKLRNFPDLPLT

ProfileScan: PS51450
IPR001611
584-605 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

EVRHLTIMTNNLSKLINDLSLK

Gene3D: G3DSA:3.80.10.10
639-799 G3DSA:3.80.10.10

LADIFKVAKDVRVLGVTYANIAFLPAEIGFLRHLRYLNLLGNRIADLPESVCDLHLLQVLDVRCSSPYLRAPNGITNLIYLRHLHASEPFLSIIPKIQNLSHLQELEVYKVSSISRIDALQGMTQLRGTLCLKDLHQVDVSELRKGILKGMQHLNILELSW

ProfileScan: PS51450
IPR001611
671-692 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLNLLGNRIADLPESVCDL

ProfileScan: PS51450
IPR001611
718-739 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLRHLHASEPFLSIIPKIQNLS

Gene3D: G3DSA:3.80.10.10
848-956 G3DSA:3.80.10.10

SLSNATSVFLTDCVNLKNLPPFHIMPCLEILEMRKIHSVNKVNTVPQRSDQIMFPKLKRLVFEDVLNCTEWSTGSSKSRNTVFPCLCEIQIRNCPKLRNFPDLPLTLTT

Gene3D: G3DSA:3.80.10.10
994-1102 G3DSA:3.80.10.10

TSRLTTLQIHQCHGLKSLGSSLLQQQHLLRSLEVLSIKNCDNVTCDLSDGFQDLTALTDLSLYDCPKLLVDKFHTSLRKLEISECFITHGAWVDDYPFLFSVWTLKVTS

superfamily: SSF52058
995-1250 SSF52058,LRR

SRLTTLQIHQCHGLKSLGSSLLQQQHLLRSLEVLSIKNCDNVTCDLSDGFQDLTALTDLSLYDCPKLLVDKFHTSLRKLEISECFITHGAWVDDYPFLFSVWTLKVTSCPHVSTDQESSFSIEPLDWLNCLFNVCSLHLENTLLLKLSMFNRLRSLEILEIDGSRSFFDDLVEEFEWLEKLQALSIRNCKELRMLPANISTLPVLEELCIENCPALEALPASGLPTSLKRLSISKCSPRLTQRCLDDEPDNLNIAK

FPrintScan: PR00364
IPR000767
1020-1036 DISEASERSIST
Disease resistance protein

HLLRSLEVLSIKNCDNV

Gene3D: G3DSA:3.80.10.10
1103-1245 G3DSA:3.80.10.10

CPHVSTDQESSFSIEPLDWLNCLFNVCSLHLENTLLLKLSMFNRLRSLEILEIDGSRSFFDDLVEEFEWLEKLQALSIRNCKELRMLPANISTLPVLEELCIENCPALEALPASGLPTSLKRLSISKCSPRLTQRCLDDEPDN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox