PRGDB00047486 (OSJNBb0096M04.140)

From PRG Wiki
Jump to: navigation, search
OSJNBb0096M04.140
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 27819519 (AC092559)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 3 BAC OSJNBb0096M04 genomic sequence, complete sequence.

DNA Sequence

ATGGAATTAGATGATTTGGATATCTTTCAGAAATGGGAGGCAGTCGATGGAACTCTAAAGGAGGAGGTAGCATTTCCTCAGCTTGACAAATTAACAATCAACGAGTGCCCAGAGCTGACTACTCTACCTGAAGCACCAAAACTAAGTGTCTTAAACATACATGAAGGCAATCAACAAATATCCCTACAGGCAGCTAGCAGATATACTACTTCATTGTCCAGTCTCCATCTGCATTTGTCAACTGATGGCACAGAAACAACATCGGTGGCCAAGCAACAAGATTCGAGTGAATTGGTGATTGAGGATGAGAAATGGAATCATAAATCTCCCCTTGAACTTATGAACTTAAATGGGTGCAACCTTTTATTCTCTCACCCAAGTGCGCTGGCTCTCTGGACATGTTTTGTTCAGCTCATAGATCTGAATATTCGGAAAGTCGATGCGCTTCTCTACTGGCCAGAAAAGGTGTTCCAGGGCTTGGTTTCCTTGAGGAAGTTAGAAGTCCCCAACCTACCTGCGTCTCTCAAGCTATTAGACATTAGGGGGTGCCGTGGCCTGGAGTCCATCATATTCAATCAGCAGCAGGATAGGACGATGTTGGTGAATGCAGAAAGCTTTGCACAGCCGGATAAGTCATCATTAATATCAGGCTCCACCAGCGAGACCAACAATCGCACCCTTCCACGCCTAGAATCTCTAGTAATATGGAACTGTGATCGTTTGGAGGTTCTCCATCTTCCTCCGTCCATCAAGAAATTGGATATTTCTTGCTGCGAAGAACTTCAGTCCCTCTCAGGAAAGCTGGATGCCGTTCAAGAATTAAATATAGAATCGTGCCAGAGCTTGAAATCACTGGAATCTTGCTTAGGAGAGCTCCCGTCGCTGCAACAACTCACCCTTTTTGATTGCGAGAGCCTGGTATCCTTGCCGAAGGGGCCTCAAGCATACTCATCTCTTACATCTCTTACAGTTAGTTATTGTTCTGGTATAAAGGTGCTTCCACCGAGCCTGCAGCAACGTCTGGATGACATCGAGGAGAAAGAGCTAGATGCCTGCTACGAAGGTAATCTCCACTTTCTTCATTTCTTTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MELDDLDIFQKWEAVDGTLKEEVAFPQLDKLTINECPELTTLPEAPKLSVLNIHEGNQQISLQAASRYTTSLSSLHLHLSTDGTETTSVAKQQDSSELVIEDEKWNHKSPLELMNLNGCNLLFSHPSALALWTCFVQLIDLNIRKVDALLYWPEKVFQGLVSLRKLEVPNLPASLKLLDIRGCRGLESIIFNQQQDRTMLVNAESFAQPDKSSLISGSTSETNNRTLPRLESLVIWNCDRLEVLHLPPSIKKLDISCCEELQSLSGKLDAVQELNIESCQSLKSLESCLGELPSLQQLTLFDCESLVSLPKGPQAYSSLTSLTVSYCSGIKVLPPSLQQRLDDIEEKELDACYEGNLHFLHFF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
3-327 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LDDLDIFQKWEAVDGTLKEEVAFPQLDKLTINECPELTTLPEAPKLSVLNIHEGNQQISLQAASRYTTSLSSLHLHLSTDGTETTSVAKQQDSSELVIEDEKWNHKSPLELMNLNGCNLLFSHPSALALWTCFVQLIDLNIRKVDALLYWPEKVFQGLVSLRKLEVPNLPASLKLLDIRGCRGLESIIFNQQQDRTMLVNAESFAQPDKSSLISGSTSETNNRTLPRLESLVIWNCDRLEVLHLPPSIKKLDISCCEELQSLSGKLDAVQELNIESCQSLKSLESCLGELPSLQQLTLFDCESLVSLPKGPQAYSSLTSLTVSYC

HMMPanther: PTHR23155:SF139
3-327 PTHR23155:SF139,OS03G0849100 PROTEIN

LDDLDIFQKWEAVDGTLKEEVAFPQLDKLTINECPELTTLPEAPKLSVLNIHEGNQQISLQAASRYTTSLSSLHLHLSTDGTETTSVAKQQDSSELVIEDEKWNHKSPLELMNLNGCNLLFSHPSALALWTCFVQLIDLNIRKVDALLYWPEKVFQGLVSLRKLEVPNLPASLKLLDIRGCRGLESIIFNQQQDRTMLVNAESFAQPDKSSLISGSTSETNNRTLPRLESLVIWNCDRLEVLHLPPSIKKLDISCCEELQSLSGKLDAVQELNIESCQSLKSLESCLGELPSLQQLTLFDCESLVSLPKGPQAYSSLTSLTVSYC

Gene3D: G3DSA:3.80.10.10
25-89 G3DSA:3.80.10.10

FPQLDKLTINECPELTTLPEAPKLSVLNIHEGNQQISLQAASRYTTSLSSLHLHLSTDGTETTSV

superfamily: SSF52047
109-339 SSF52047,LRR

SPLELMNLNGCNLLFSHPSALALWTCFVQLIDLNIRKVDALLYWPEKVFQGLVSLRKLEVPNLPASLKLLDIRGCRGLESIIFNQQQDRTMLVNAESFAQPDKSSLISGSTSETNNRTLPRLESLVIWNCDRLEVLHLPPSIKKLDISCCEELQSLSGKLDAVQELNIESCQSLKSLESCLGELPSLQQLTLFDCESLVSLPKGPQAYSSLTSLTVSYCSGIKVLPPSLQQ

Gene3D: G3DSA:3.80.10.10
221-328 G3DSA:3.80.10.10

ETNNRTLPRLESLVIWNCDRLEVLHLPPSIKKLDISCCEELQSLSGKLDAVQELNIESCQSLKSLESCLGELPSLQQLTLFDCESLVSLPKGPQAYSSLTSLTVSYCS

HMMPfam: PF13504
293-310 LRR_7,Leucine rich repeat

PSLQQLTLFDCESLVSLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox