PRGDB00047488 (OSJNBb0004A06.19)

From PRG Wiki
Jump to: navigation, search
OSJNBb0004A06.19
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22830257 (AC099734)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome 10 clone OSJNBb0004A06, complete sequence.

DNA Sequence

ATGGAGTTGGTGGTTGGTGCTTCGACTGCCACCATGGACTCTCTCCTGGGCAAGCTGGGCAACCTTCTCGCCCAGGAGTATGATCTGATCAGGGGCGTCCGTGGTGACATCCAGTACATCAGTGACGAGCTCGCCAGCATGAAGGCCTTCCTTCTTGACCTCGCCCGGGAAGACCCTGACAACAGGAAGAAGCACTGGATGAAGCAGATCCGCGACATGGCATATGACTGTGAGGACTGCATAGATGACTTTGCTCACCGCCTCCCCAACGATTCCTTGGATGCAAAATGCTGCCCCTGGATAGTCACACTAGTGTATGACCTCTGGACGTTCGGGCCTCGCCGTGAGATTGCATCCAGTATTGCTGAGCTTAAGGTCCGGGCGCAGCTGATTGCTGACCGACGCATAAGATACGGAGTGGAAAATCCAAATACCCAAAAAGGCAAGGGCCCGCCCGATGCGACGTCTTATGACATTGCTGAGGATCAGCTCGCAAGCCATGAGCTTGGTATGAATGAGCCTGTAGGGATGGAGAAGGCCATGAAGGATCTTGAGGAGTGGGTGGACGGCACTGCTTGTCAGGAGCCTGCTGTTGTGTCCATTGTTGGATTTGGGGGTGTGGGGAAGACCACCATTGCCATGGCATTGTACAAGAAAGTCATGTATCAATTTGATTGCCGGGCGTGGGTTACTGTGTCCCAGAACTATGACCTTGATGCCGTACTCAATGATATTCTCAAGCAAATAGACCCAGATTACAGGCAGCAATGCAGCAGCAAGACTGGAACCTCTGAGAATATCAAGACACTGGCACGCTTTGGAAGCAAATTGAAGCGAGACGTGCAGCGCACAGGAAGTCTCCGTCAAAGCAGCCCTCGCAGTATTGAGGAGACCTCCAATCTAAAGCGCACAGAAACCACCGACAACAAACTCGAAAGCCAAATAAAGAAGCTCCTGGATAAAAAGAGGTGTGTACATCCATCCATCCATCTATCTATATCTATATCTATATCTATATACTAA


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MELVVGASTATMDSLLGKLGNLLAQEYDLIRGVRGDIQYISDELASMKAFLLDLAREDPDNRKKHWMKQIRDMAYDCEDCIDDFAHRLPNDSLDAKCCPWIVTLVYDLWTFGPRREIASSIAELKVRAQLIADRRIRYGVENPNTQKGKGPPDATSYDIAEDQLASHELGMNEPVGMEKAMKDLEEWVDGTACQEPAVVSIVGFGGVGKTTIAMALYKKVMYQFDCRAWVTVSQNYDLDAVLNDILKQIDPDYRQQCSSKTGTSENIKTLARFGSKLKRDVQRTGSLRQSSPRSIEETSNLKRTETTDNKLESQIKKLLDKKRCVHPSIHLSISISISIY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
8-249 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

STATMDSLLGKLGNLLAQEYDLIRGVRGDIQYISDELASMKAFLLDLAREDPDNRKKHWMKQIRDMAYDCEDCIDDFAHRLPNDSLDAKCCPWIVTLVYDLWTFGPRREIASSIAELKVRAQLIADRRIRYGVENPNTQKGKGPPDATSYDIAEDQLASHELGMNEPVGMEKAMKDLEEWVDGTACQEPAVVSIVGFGGVGKTTIAMALYKKVMYQFDCRAWVTVSQNYDLDAVLNDILKQI

HMMPanther: PTHR23155:SF220
8-249 PTHR23155:SF220,OS11G0689100 PROTEIN

STATMDSLLGKLGNLLAQEYDLIRGVRGDIQYISDELASMKAFLLDLAREDPDNRKKHWMKQIRDMAYDCEDCIDDFAHRLPNDSLDAKCCPWIVTLVYDLWTFGPRREIASSIAELKVRAQLIADRRIRYGVENPNTQKGKGPPDATSYDIAEDQLASHELGMNEPVGMEKAMKDLEEWVDGTACQEPAVVSIVGFGGVGKTTIAMALYKKVMYQFDCRAWVTVSQNYDLDAVLNDILKQI

superfamily: SSF52540
157-259 SSF52540

YDIAEDQLASHELGMNEPVGMEKAMKDLEEWVDGTACQEPAVVSIVGFGGVGKTTIAMALYKKVMYQFDCRAWVTVSQNYDLDAVLNDILKQIDPDYRQQCSS

Gene3D: G3DSA:3.40.50.300
176-268 G3DSA:3.40.50.300

GMEKAMKDLEEWVDGTACQEPAVVSIVGFGGVGKTTIAMALYKKVMYQFDCRAWVTVSQNYDLDAVLNDILKQIDPDYRQQCSSKTGTSENIK

HMMPfam: PF00931
IPR002182
179-324 NB-ARC,NBS
NB-ARC

KAMKDLEEWVDGTACQEPAVVSIVGFGGVGKTTIAMALYKKVMYQFDCRAWVTVSQNYDLDAVLNDILKQIDPDYRQQCSSKTGTSENIKTLARFGSKLKRDVQRTGSLRQSSPRSIEETSNLKRTETTDNKLESQIKKLLDKKRC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox