PRGDB00047489 (OSJNBb0004A06.19)

From PRG Wiki
Jump to: navigation, search
OSJNBb0004A06.19
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22830257 (AC099734)
Gene Class NL
Domain Type NBS, LRR, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome 10 clone OSJNBb0004A06, complete sequence.

DNA Sequence

GTATATAATCCTGGTTGACGACATATGGTCTGCAAAAACATGGAAAACAATATCAGATTATTTGTTGCTAACTGATAATAAAGAGCGCAGTAGAATAATAGTTACTTCAAGATTTCAAGCGGTTGGTTCGACCTGCTGCCGGCCAGAAAACAAGGATCTATTGTATCCGATTAGTTTCCTCAGTCCTCGTGATTCCAAGGAGCTATTCAACCGAAGTGTTTCTGAATCCAAAAGCACCAAAGATAGACACAAGGTACAGAACAATGTCCCTGGTGATTTATGGAAAAGGTGTGGGGGTCAGCCTTTGGCCATAGTTACCATGGCTGGTCTAGTGGCGTGCAACCAAGACCAGCCAAAGAGTTACTGGGCTGGACTTCACAAATTATTGCCAGAAGAGGTTTCTATTACTGCTGGGGCTCAGGAACAAGAAACTTCTCTCAATTTGGATGGGGTTACAAGGATACTTGATTGTTGCTACAATAATTTGCCTGGATATCTCAGAACCTGCTTACTGTACTTGGCAATATTTCCAAAGGGTTGGAAAATTAGTAGGAAGTGTCTGTCCAGGCGATGGATTGCTGAAGGTTTTGTCAATGCAAAGCAAGGGCTGACGGCGGAGGAAGTTGCGGAATCATACTTCAATCATATTTTAAGAAGAAAGTTGATACGTCCTGTGGAGCACAGCAGCAACGGGAAACTAAAAACCTTTCAAGTTCATGACATGGTTCTTGACTATATTGTGACCAAGGCAAGAGAAGAGAATTTTATTACTGTGGTTGGTGGTCATCTGATGATGATAGCACCCAGTAATAACAAAGTCCGTCGGCTTTCCATGCAGAGCAGCAGTTCCAAGCATGGAGATTCAACAAAAGGCATGAATCTGTCACAAGTTCGGTCACTGACCGTTTTCGGGAGCCTCACCCAGCTTCCATTCCATGCTTTCAATGACAGAATAATACAAGTCCTGGATTTTCAAGGACTGAAGGGATTCAAGAACAGGCATATGAAACACATTTGTAAGATGTTTGTGCTGAAGTATTTGAGCCTCCGAGGGACGGATATTACCCATGTTCCGCCGACGATTGTGAAGCTCGAGTATTTGGAAACTCTTGACATAAGAGAAACACGTGTTAAAGAGCTGCCGAAAGAAGTAGAGCAGCTAAAACTAATCAGCAGAATACTTGGTGGGAGTAAAAACAAAAACCCACGGAAAGGGTTGAGGCTGCCTCAAGAAAAAAGTAAGAAGCAGCAACACAAAAGTATGTTGACCCAAGATAAAGAGAAGGAAGGAATGAAAGCACTCCGGATACTGTCTGGGATCAAGATCGATGAGACAACAGCTGTAGCAGGCCTTCATCAATTGACGGGTCTAAAGAAGCTTACTATTTACAAGCTCAAGCTCAACCCAGAGGAACCGGGCACAAGGAAAATCTTGACAGAACTACGCTCTTCTATTGAGTATCTTTGCAGCTGTGGTCTCCAGACTTTGGCGATCAATGAGGAAGGTCAATCTAATTTTATCAACTCCTTGGGTAACATGTCCGCACCCCCAAGATATCTTGTTGCCCTTGAGCTTTCCGGCATGTTGAAAAAACCCCCAGGTTGGATCAAGACACTACGGACATTGAGCAAGCTAACTCTGTCTCTAACAGTTCTCCGGACAGATACTCTAGAGCACCTCCGTGCCCTGCCGCTGTTTTCTCTTACCTTTTCTTTCTCATTTGGTGAGATGGAGAAGGATCAGGACAAAAAGATGAAGGACATCATCGAGGACAACAAATCACTGTCCGATGGGGAGATCTTTGTTCCAGGTGAAGGATTCAAGAGTCTTAAGCTACTTCGCTTCTTTGCACCTCTTGTTCCAAAGCTAGGCTTCTGTCACAATGCAATGCCAGCCCTTGAGATGATTGAGATGCAGTTTCAAGCGTTTGAAGGCCTATTTGGCATTGACACGCTAGGAAATCTCAAAGGGGTGCGCCTCAGAGAAGCTAAACCAAGAGAAGAGGATAAGCAAACCGCTCAAATAAATGACCTGTTGGTACGAGATTTGAAAGATAGCACTGAGGGACTGAAGGTAATCATTGATCACACATTCACTTCTTGAATGGGAAGGGGTGGGACGGAGGGGAGGAGCAGCGGCGCCGGATCTGGCCACCCGCGAGCGCCGGTGGCTGGTGGGAAGGAACGAGAGGAGGAGGTGGCCAGTGGCCTTCCCACACTGTCGCTGCCGGTGGAGGAGGTAGAGAAGGAGGTGAGGGGAAATGGGAGGAGGAGGAGGGGAAAGGTGAGGGGAAAGGCGAGACAGAGAATGAGCGGTGGTGGGAG


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MGRGGTEGRSSGAGSGHPRAPVAGGKEREEEVASGLPTLSLPVEEVEKEVRGNGRRRRGKVRGKARQRMSGGGRYIILVDDIWSAKTWKTISDYLLLTDNKERSRIIVTSRFQAVGSTCCRPENKDLLYPISFLSPRDSKELFNRSVSESKSTKDRHKVQNNVPGDLWKRCGGQPLAIVTMAGLVACNQDQPKSYWAGLHKLLPEEVSITAGAQEQETSLNLDGVTRILDCCYNNLPGYLRTCLLYLAIFPKGWKISRKCLSRRWIAEGFVNAKQGLTAEEVAESYFNHILRRKLIRPVEHSSNGKLKTFQVHDMVLDYIVTKAREENFITVVGGHLMMIAPSNNKVRRLSMQSSSSKHGDSTKGMNLSQVRSLTVFGSLTQLPFHAFNDRIIQVLDFQGLKGFKNRHMKHICKMFVLKYLSLRGTDITHVPPTIVKLEYLETLDIRETRVKELPKEVEQLKLISRILGGSKNKNPRKGLRLPQEKSKKQQHKSMLTQDKEKEGMKALRILSGIKIDETTAVAGLHQLTGLKKLTIYKLKLNPEEPGTRKILTELRSSIEYLCSCGLQTLAINEEGQSNFINSLGNMSAPPRYLVALELSGMLKKPPGWIKTLRTLSKLTLSLTVLRTDTLEHLRALPLFSLTFSFSFGEMEKDQDKKMKDIIEDNKSLSDGEIFVPGEGFKSLKLLRFFAPLVPKLGFCHNAMPALEMIEMQFQAFEGLFGIDTLGNLKGVRLREAKPREEDKQTAQINDLLVRDLKDSTEGLKVIIDHTFTS


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
57-275 NB-ARC,NBS
NB-ARC

RRGKVRGKARQRMSGGGRYIILVDDIWSAKTWKTISDYLLLTDNKERSRIIVTSRFQAVGSTCCRPENKDLLYPISFLSPRDSKELFNRSVSESKSTKDRHKVQNNVPGDLWKRCGGQPLAIVTMAGLVACNQDQPKSYWAGLHKLLPEEVSITAGAQEQETSLNLDGVTRILDCCYNNLPGYLRTCLLYLAIFPKGWKISRKCLSRRWIAEGFVNAKQ

HMMPanther: PTHR23155:SF191
74-774 PTHR23155:SF191,OS10G0131700 PROTEIN

RYIILVDDIWSAKTWKTISDYLLLTDNKERSRIIVTSRFQAVGSTCCRPENKDLLYPISFLSPRDSKELFNRSVSESKSTKDRHKVQNNVPGDLWKRCGGQPLAIVTMAGLVACNQDQPKSYWAGLHKLLPEEVSITAGAQEQETSLNLDGVTRILDCCYNNLPGYLRTCLLYLAIFPKGWKISRKCLSRRWIAEGFVNAKQGLTAEEVAESYFNHILRRKLIRPVEHSSNGKLKTFQVHDMVLDYIVTKAREENFITVVGGHLMMIAPSNNKVRRLSMQSSSSKHGDSTKGMNLSQVRSLTVFGSLTQLPFHAFNDRIIQVLDFQGLKGFKNRHMKHICKMFVLKYLSLRGTDITHVPPTIVKLEYLETLDIRETRVKELPKEVEQLKLISRILGGSKNKNPRKGLRLPQEKSKKQQHKSMLTQDKEKEGMKALRILSGIKIDETTAVAGLHQLTGLKKLTIYKLKLNPEEPGTRKILTELRSSIEYLCSCGLQTLAINEEGQSNFINSLGNMSAPPRYLVALELSGMLKKPPGWIKTLRTLSKLTLSLTVLRTDTLEHLRALPLFSLTFSFSFGEMEKDQDKKMKDIIEDNKSLSDGEIFVPGEGFKSLKLLRFFAPLVPKLGFCHNAMPALEMIEMQFQAFEGLFGIDTLGNLKGVRLREAKPREEDKQTAQINDLLVRDLKDSTEGLKVIIDHTFTS

HMMPanther: PTHR23155
74-774 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RYIILVDDIWSAKTWKTISDYLLLTDNKERSRIIVTSRFQAVGSTCCRPENKDLLYPISFLSPRDSKELFNRSVSESKSTKDRHKVQNNVPGDLWKRCGGQPLAIVTMAGLVACNQDQPKSYWAGLHKLLPEEVSITAGAQEQETSLNLDGVTRILDCCYNNLPGYLRTCLLYLAIFPKGWKISRKCLSRRWIAEGFVNAKQGLTAEEVAESYFNHILRRKLIRPVEHSSNGKLKTFQVHDMVLDYIVTKAREENFITVVGGHLMMIAPSNNKVRRLSMQSSSSKHGDSTKGMNLSQVRSLTVFGSLTQLPFHAFNDRIIQVLDFQGLKGFKNRHMKHICKMFVLKYLSLRGTDITHVPPTIVKLEYLETLDIRETRVKELPKEVEQLKLISRILGGSKNKNPRKGLRLPQEKSKKQQHKSMLTQDKEKEGMKALRILSGIKIDETTAVAGLHQLTGLKKLTIYKLKLNPEEPGTRKILTELRSSIEYLCSCGLQTLAINEEGQSNFINSLGNMSAPPRYLVALELSGMLKKPPGWIKTLRTLSKLTLSLTVLRTDTLEHLRALPLFSLTFSFSFGEMEKDQDKKMKDIIEDNKSLSDGEIFVPGEGFKSLKLLRFFAPLVPKLGFCHNAMPALEMIEMQFQAFEGLFGIDTLGNLKGVRLREAKPREEDKQTAQINDLLVRDLKDSTEGLKVIIDHTFTS

superfamily: SSF52058
311-736 SSF52058,LRR

QVHDMVLDYIVTKAREENFITVVGGHLMMIAPSNNKVRRLSMQSSSSKHGDSTKGMNLSQVRSLTVFGSLTQLPFHAFNDRIIQVLDFQGLKGFKNRHMKHICKMFVLKYLSLRGTDITHVPPTIVKLEYLETLDIRETRVKELPKEVEQLKLISRILGGSKNKNPRKGLRLPQEKSKKQQHKSMLTQDKEKEGMKALRILSGIKIDETTAVAGLHQLTGLKKLTIYKLKLNPEEPGTRKILTELRSSIEYLCSCGLQTLAINEEGQSNFINSLGNMSAPPRYLVALELSGMLKKPPGWIKTLRTLSKLTLSLTVLRTDTLEHLRALPLFSLTFSFSFGEMEKDQDKKMKDIIEDNKSLSDGEIFVPGEGFKSLKLLRFFAPLVPKLGFCHNAMPALEMIEMQFQAFEGLFGIDTLGNLKGVRLRE

Gene3D: G3DSA:3.80.10.10
358-454 G3DSA:3.80.10.10

KHGDSTKGMNLSQVRSLTVFGSLTQLPFHAFNDRIIQVLDFQGLKGFKNRHMKHICKMFVLKYLSLRGTDITHVPPTIVKLEYLETLDIRETRVKEL

Gene3D: G3DSA:3.80.10.10
522-643 G3DSA:3.80.10.10

VAGLHQLTGLKKLTIYKLKLNPEEPGTRKILTELRSSIEYLCSCGLQTLAINEEGQSNFINSLGNMSAPPRYLVALELSGMLKKPPGWIKTLRTLSKLTLSLTVLRTDTLEHLRALPLFSLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox