PRGDB00047490 (OSJNAb0072F04.20)

From PRG Wiki
Jump to: navigation, search
OSJNAb0072F04.20
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21104880 (AC122147)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome 10 clone OSJNAb0072F04, complete sequence.

DNA Sequence

ATGGATATCGTGGTGAGCGTCTCACATGGGGCACTGGGACCACTGCTGGGCAAGCTCAATACCTTGCTCGTAGACGAGTGCGCACGCCTGAAAGGTGTCCACCGTGAGATACGCTCTCTTAGATCGGAGTTGAGCAACATGCATGCGGCGCTCCACAAGTACACATCACTCGAGGATCCTGACATCCAGGTGAAGACCTGGACAAGCGAGTTGAGGGAGCTTGCCTATGACATCGAGGACTGCATAGACAAGTTCATGCACCAACTTGGTGCCAACGACGACCAGCACCACACTAGTAATGGCGTCAAGGACTTCTTCGGGAAGAGTGCAAAACGTCTCAAAACTCTTGGCTCAAGGCATAATATTGCTGCCGAGATTGAAGAACTGAAGATGCGAGTTATCTCGGTGAGAGATCAAAAGAACAACTACAAGCTTGATGATATTTTTTGTAGTAGCTCTAGCAACACTAATGCTTTTGTTGATCCACGGTTGGCTGCTCTCTTCGCGGAAGAGAACCATCTTGTCGGTATAGATAGTCCAAGGGATGAACTTGTCAATTGGTTGGATGCAGACAGCAGGTCAATTGTGGGGTTTGGAGGTCTTGGAAAGACAACTCTAGCAAATGAGGTATATCGTAGGGTTAAAATCCATTTTGATTGCCCTGCTTTTACGTCGGTATCACAAAAGCCTGATATGAAGAAAATCTTCAAGGATATTATATACCATATGCCTACAAAAGATGCATTCCTCAAAGATATTGACACATGGAATGAAAAGAAATTTATTGAAAAGCTAAGAGAACTACTTGTGGATAAGAGGTATCTTGTTATAATTGATGATGTCTGGTCTATTTCGGCATGGAAAGCTATCAGTGTTGTTTTCCCGGAGAATGGTTCTAGTATAATTATAGTTACTACACGCATTTCCGATGTTGGACGGTCATGCTGCTTAAATGGAATTGACCGCAATTTTGAGATGGAACCTCTAAGTGAAATTCACTCTAGAAGACTATTTTGCCAGAGAATTTTCAGCACAGATGAGGATGGCTGCCCAGATATTTTACAAGAAGTTTCAACAGATATCTTGAAGAAATGTGGGGGTATTCCATTAGCAATTATTAGTATATCTGGTTTGTTATCAAACAGACCAATTATCAAGGAAGAGTGGGAGAAAGTGAAAGAATCGATTGGTTTTGTATTGGACAAGAACCAAAATCTAGAAGGAATGAAAAGCATACTCTCCCTTAGCTACAATGACCTTCCAAACTATTTTAAGGCATGTTTGATATATTTGTGCATATTTCCAGAGGATTATATTATTGAAACAAACATGCTATTACGGCGATGGATAGCTGAAGGCTTTGTCTCTGAGGATTGTGGAATGAACTTGGAAGATGTTGCAGAGAGCTACTTTTGTGAGCTGGTCAACAGAAGCCTGGTCCAACCTGTGGACATTCGCTTTGACAGTAAGGCCCGTGCATGCCGCGTCCATGATATAATGCTTGAACTTATCACTTCAAAGGCGACAGAAGAAAACTTTATTACATTGTTACGTGGCCAAACAAGGAAAACAAATTTGCATGGCTACGTTCGTCGATTATCCATCCAGGACACTGATAATGATTTGTCAAGTCTGTTAGTAAACAAAGATTTAAGCCATGTTCGATCTCTAACCTGCTTTGGTGGGAACATGAATCTTTTGCCACAGCTTGCCCGATTTGAGGCTATACGAGTGTTGGAGTTTGAAGGCTCTATGAATTTGGAGCAGTATGATTTGGAAAATACAGACAAGCTATTCCAACTCAAGTACTTAAGCCTTCGTGGTTCAGACATATCACACATACCAAGACAAATTGCAAAGCTCCAAAATTTGCTGACATTGGACATAAGTGAAACATTCGTAGAAGAGCTGCCCACCGAATTATGCCTGTTGAAAAAGTTACTACATCTATTCGGAAATTCCTTGAAGCTACCAGATGGGATTGGGAATATGAGGAATCTACAGGTGCTGACAGGCATTAATATAAGTAATAGCTCAGCAAGTACAGTGCCCGAGCTTGGTGAACTAACCAGTTTGAGGGACCTCAAAATAAGTTTGTCTGATAAACTCAGCAAGTGCAAGACAAAAGAAGAGATGTTACTCGCCTCACTTTGTAAACTAAGCAGCTACAAACTCCAATCGTTGCATATTATATATAACAGTTCCGATGATCTCTTAGAACGTTGGTTCCCTATCCCTTGTTTCCTCCGATTGTTTCGCATGAGCACTAATCACTTTCTCCCACAACTTCCAAAGTGGATTAAACCGAGTCTCACCAAAATGGCATACCTGAACATCAATTTACGTGAGATAAAGGAGGAAGATATGGAAACACTTGGAGACCTGCCAGCCTTACTCTGTCTAGAAATATGGCTAGAACCTAACCCAAAAAAACAGCTTACAGTCCAAAGCACAGGATTCCCATGTCTCAAGGAGTTTCTCCTTGTTTGCGGCGATCACGATGGTGGAGCGTACCTAACATTTGGGAAAGGGGCTATGCCAAAGCTGGAGAAGCTTGAGATTCCATTTCACGTATTAATGGCAAAATCCCATGGGAAAGGAAGCCCCAAAGGAGGGAGGGCCACTGAAGATTACGGTCATGGGCCATCCGCATCAAGACGTCTTCAATATGGATTTAACAAAGTGCTAGCAAGTTCAACAGCCTCCAACGCCCTTCGGGGGAAAGAAGCCCCTAAGGGGGGAGGGCTGCTAAACAATGTGGCCAAGACAACCAGGGGACTGTACGTTCTGATACCGAGTCTGCGGTGGCTGCAATCAAGAGAGAAGCAAGTGCAAATCCCAACCATCCTAGACTTGCCATCTTCGGAGCAGATGCAGAAGAGGTCCAAGAGGATAATAGCGAAGAGAGTGATTATAACTGGGGTTCAGAGGATGACGATGCTACTGACACCTGATATTGTTGCCAGCCATGATCTTTCTGGCAACCCATGA


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MDIVVSVSHGALGPLLGKLNTLLVDECARLKGVHREIRSLRSELSNMHAALHKYTSLEDPDIQVKTWTSELRELAYDIEDCIDKFMHQLGANDDQHHTSNGVKDFFGKSAKRLKTLGSRHNIAAEIEELKMRVISVRDQKNNYKLDDIFCSSSSNTNAFVDPRLAALFAEENHLVGIDSPRDELVNWLDADSRSIVGFGGLGKTTLANEVYRRVKIHFDCPAFTSVSQKPDMKKIFKDIIYHMPTKDAFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAISVVFPENGSSIIIVTTRISDVGRSCCLNGIDRNFEMEPLSEIHSRRLFCQRIFSTDEDGCPDILQEVSTDILKKCGGIPLAIISISGLLSNRPIIKEEWEKVKESIGFVLDKNQNLEGMKSILSLSYNDLPNYFKACLIYLCIFPEDYIIETNMLLRRWIAEGFVSEDCGMNLEDVAESYFCELVNRSLVQPVDIRFDSKARACRVHDIMLELITSKATEENFITLLRGQTRKTNLHGYVRRLSIQDTDNDLSSLLVNKDLSHVRSLTCFGGNMNLLPQLARFEAIRVLEFEGSMNLEQYDLENTDKLFQLKYLSLRGSDISHIPRQIAKLQNLLTLDISETFVEELPTELCLLKKLLHLFGNSLKLPDGIGNMRNLQVLTGINISNSSASTVPELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIYNSSDDLLERWFPIPCFLRLFRMSTNHFLPQLPKWIKPSLTKMAYLNINLREIKEEDMETLGDLPALLCLEIWLEPNPKKQLTVQSTGFPCLKEFLLVCGDHDGGAYLTFGKGAMPKLEKLEIPFHVLMAKSHGKGSPKGGRATEDYGHGPSASRRLQYGFNKVLASSTASNALRGKEAPKGGGLLNNVAKTTRGLYVLIPSLRWLQSREKQVQIPTILDLPSSEQMQKRSKRIIAKRVIITGVQRMTMLLTPDIVASHDLSGNP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF189
8-854 PTHR23155:SF189,OS10G0131000 PROTEIN

SHGALGPLLGKLNTLLVDECARLKGVHREIRSLRSELSNMHAALHKYTSLEDPDIQVKTWTSELRELAYDIEDCIDKFMHQLGANDDQHHTSNGVKDFFGKSAKRLKTLGSRHNIAAEIEELKMRVISVRDQKNNYKLDDIFCSSSSNTNAFVDPRLAALFAEENHLVGIDSPRDELVNWLDADSRSIVGFGGLGKTTLANEVYRRVKIHFDCPAFTSVSQKPDMKKIFKDIIYHMPTKDAFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAISVVFPENGSSIIIVTTRISDVGRSCCLNGIDRNFEMEPLSEIHSRRLFCQRIFSTDEDGCPDILQEVSTDILKKCGGIPLAIISISGLLSNRPIIKEEWEKVKESIGFVLDKNQNLEGMKSILSLSYNDLPNYFKACLIYLCIFPEDYIIETNMLLRRWIAEGFVSEDCGMNLEDVAESYFCELVNRSLVQPVDIRFDSKARACRVHDIMLELITSKATEENFITLLRGQTRKTNLHGYVRRLSIQDTDNDLSSLLVNKDLSHVRSLTCFGGNMNLLPQLARFEAIRVLEFEGSMNLEQYDLENTDKLFQLKYLSLRGSDISHIPRQIAKLQNLLTLDISETFVEELPTELCLLKKLLHLFGNSLKLPDGIGNMRNLQVLTGINISNSSASTVPELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIYNSSDDLLERWFPIPCFLRLFRMSTNHFLPQLPKWIKPSLTKMAYLNINLREIKEEDMETLGDLPALLCLEIWLEPNPKKQLTVQSTGFPCLKEFLLVCGDHDGGAYLTFGKGAMPKLEKLEI

HMMPanther: PTHR23155
8-854 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SHGALGPLLGKLNTLLVDECARLKGVHREIRSLRSELSNMHAALHKYTSLEDPDIQVKTWTSELRELAYDIEDCIDKFMHQLGANDDQHHTSNGVKDFFGKSAKRLKTLGSRHNIAAEIEELKMRVISVRDQKNNYKLDDIFCSSSSNTNAFVDPRLAALFAEENHLVGIDSPRDELVNWLDADSRSIVGFGGLGKTTLANEVYRRVKIHFDCPAFTSVSQKPDMKKIFKDIIYHMPTKDAFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAISVVFPENGSSIIIVTTRISDVGRSCCLNGIDRNFEMEPLSEIHSRRLFCQRIFSTDEDGCPDILQEVSTDILKKCGGIPLAIISISGLLSNRPIIKEEWEKVKESIGFVLDKNQNLEGMKSILSLSYNDLPNYFKACLIYLCIFPEDYIIETNMLLRRWIAEGFVSEDCGMNLEDVAESYFCELVNRSLVQPVDIRFDSKARACRVHDIMLELITSKATEENFITLLRGQTRKTNLHGYVRRLSIQDTDNDLSSLLVNKDLSHVRSLTCFGGNMNLLPQLARFEAIRVLEFEGSMNLEQYDLENTDKLFQLKYLSLRGSDISHIPRQIAKLQNLLTLDISETFVEELPTELCLLKKLLHLFGNSLKLPDGIGNMRNLQVLTGINISNSSASTVPELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIYNSSDDLLERWFPIPCFLRLFRMSTNHFLPQLPKWIKPSLTKMAYLNINLREIKEEDMETLGDLPALLCLEIWLEPNPKKQLTVQSTGFPCLKEFLLVCGDHDGGAYLTFGKGAMPKLEKLEI

superfamily: SSF52540
157-396 SSF52540

NAFVDPRLAALFAEENHLVGIDSPRDELVNWLDADSRSIVGFGGLGKTTLANEVYRRVKIHFDCPAFTSVSQKPDMKKIFKDIIYHMPTKDAFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAISVVFPENGSSIIIVTTRISDVGRSCCLNGIDRNFEMEPLSEIHSRRLFCQRIFSTDEDGCPDILQEVSTDILKKCGGIPLAIISISGLLSNRPIIKEEWEKVKESI

Gene3D: G3DSA:3.40.50.300
178-295 G3DSA:3.40.50.300

DSPRDELVNWLDADSRSIVGFGGLGKTTLANEVYRRVKIHFDCPAFTSVSQKPDMKKIFKDIIYHMPTKDAFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAISVVFP

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

SRSIVGFGGLGKTTLA

HMMPfam: PF00931
IPR002182
194-458 NB-ARC,NBS
NB-ARC

SIVGFGGLGKTTLANEVYRRVKIHFDCPAFTSVSQKPDMKKIFKDIIYHMPTKDAFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAISVVFPENGSSIIIVTTRISDVGRSCCLNGIDRNFEMEPLSEIHSRRLFCQRIFSTDEDGCPDILQEVSTDILKKCGGIPLAIISISGLLSNRPIIKEEWEKVKESIGFVLDKNQNLEGMKSILSLSYNDLPNYFKACLIYLCIFPEDYIIETNMLLRRWIAEGFVSED

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

LLVDKRYLVIIDDVW

FPrintScan: PR00364
IPR000767
365-379 DISEASERSIST
Disease resistance protein

CGGIPLAIISISGLL

superfamily: SSF52058
495-856 SSF52058,LRR

RVHDIMLELITSKATEENFITLLRGQTRKTNLHGYVRRLSIQDTDNDLSSLLVNKDLSHVRSLTCFGGNMNLLPQLARFEAIRVLEFEGSMNLEQYDLENTDKLFQLKYLSLRGSDISHIPRQIAKLQNLLTLDISETFVEELPTELCLLKKLLHLFGNSLKLPDGIGNMRNLQVLTGINISNSSASTVPELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIYNSSDDLLERWFPIPCFLRLFRMSTNHFLPQLPKWIKPSLTKMAYLNINLREIKEEDMETLGDLPALLCLEIWLEPNPKKQLTVQSTGFPCLKEFLLVCGDHDGGAYLTFGKGAMPKLEKLEIPF

Gene3D: G3DSA:3.80.10.10
538-700 G3DSA:3.80.10.10

TDNDLSSLLVNKDLSHVRSLTCFGGNMNLLPQLARFEAIRVLEFEGSMNLEQYDLENTDKLFQLKYLSLRGSDISHIPRQIAKLQNLLTLDISETFVEELPTELCLLKKLLHLFGNSLKLPDGIGNMRNLQVLTGINISNSSASTVPELGELTSLRDLKISLS

FPrintScan: PR00364
IPR000767
619-635 DISEASERSIST
Disease resistance protein

AKLQNLLTLDISETFVE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox