PRGDB00047501 (OSJNBa0013O08.4)

From PRG Wiki
Jump to: navigation, search
OSJNBa0013O08.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 16756245 (AC084762)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 3 BAC OSJNBa0013O08 genomic sequence, complete sequence.

DNA Sequence

ATATTGCCTCTGGTTTTAAATGGCGGAGGCGATCATCGGGCCGCTGGTGTGGAGGCTGCAGGAGATGGCGGTGGGGCAGGCTCGGGCGCTGGTGTCGGTGAACGACGACATCGTGAGGCTCCGGGACAGGCTGATGTGGCTGCAGGCCTTCCTCCGGGAGGCCGACGCCAAGCGACGCGCCGTCTCCGACGAGGTCAACAAGGTGTGGCTGCTGCAGACGCGCGACGCCGTCTTCGACGCCGAGGACGCCCTCGATCATTTCTATCTCCGCGTCGATATGTCCAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa].

MAEAIIGPLVWRLQEMAVGQARALVSVNDDIVRLRDRLMWLQAFLREADAKRRAVSDEVNKVWLLQTRDAVFDAEDALDHFYLRVDMSRYCLWF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-93 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAEAIIGPLVWRLQEMAVGQARALVSVNDDIVRLRDRLMWLQAFLREADAKRRAVSDEVNKVWLLQTRDAVFDAEDALDHFYLRVDMSRYCLW

HMMPanther: PTHR23155:SF172
1-93 OS08G0293300 PROTEIN,OS08G0293300 PROTEIN

MAEAIIGPLVWRLQEMAVGQARALVSVNDDIVRLRDRLMWLQAFLREADAKRRAVSDEVNKVWLLQTRDAVFDAEDALDHFYLRVDMSRYCLW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox