PRGDB00047518 (F2G19.30)

From PRG Wiki
Jump to: navigation, search
F2G19.30
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12320997 (AC083835)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC F2G19 genomic sequence, complete sequence.

DNA Sequence

ATGACAGGCTTATACTCATCAATGAGCTTTTTTCTTCGTACCATTGTTCTTCTTTTCTCCACTTCAAGTTTTTGCAACACTTTTGCTTCTCTTACACAAGACTCATGCCATCCCGACCAAAGAGATGCGCTTCTCGAGTTCAAGAATGAATTCAAGATTTGGTATCCCAATGGTTTTCTTGATATTGATGGTGTTCTAATGGATGTTACCTCTTATCCGAAGACGAAATCATGGACAAAAAACAGTGATTGTTGCTATTGGGACGGTATCACTTGCGATACCAAGTCGGGCAAGGTGACCGGGCTAGACCTTAGTTGCAGCTGTCTTCATGGCCGGCTCGAACCTAATAGTAGTCTTTTTAGACTACAACATCTCCAAAGTGTGAACCTTGCTTACAACAATTTCACCAACTCTCCCATCCCAGCTGAGTTCAGCAAATTCATGAGGTTAGAAAGACTTAACCTCTCACGGTCTTCATTTTCAGGTCATATTTCAATCAAACTTCTTCAGCTAACCAATTTGGTGTCTCTTGATCTTTCTTCTTCTTTTCCGTATTCTCCAAGTTCTTTGTCCATTGAAAAACCATTATTTCTCCATCTACTTGCACTGAACTTCATGAACCTTAGAGAGCTAGATATGAGCTCCGTAGACATTTCTTCAGCAATCCCCATTGAGTTTTCATACATGTGGTCTCTAAGATCACTTACTCTTAAGGGCTGCAACCTCTTAGGAAGATTTCCAAACAGTGTTCTTCTCATACCAAACCTAGAATCCATTAGCTTGGACCACAATCTGAATCTAGAAGGCAGTCTTCCCAATTTTCTTAGAAACAACTCTTTGCTAAAGTTGAGCATTTACAACACTTCTTTTTCAGGTACTATACCTAACTCTATCAGCAACCTCAAACATTTGACTTCTTTAAAACTTCAACAATCCGCTTTCTCCGGGAGGATTCCATCTTCACTTCGGAGCCTTTCCCATCTCTCAAATCTTGTTCTTTCCGAAAACAATTTCGTTGGCGAAATCCCATCTTCAGTTAGTAATCTTAAACAACTTACCCTTTTCGATGTTTCAGATAACAACCTTAACGGAAACTTTCCATCCTCTCTGCTCAATTTGAACCAACTACGCTATATTGATATATGTTCCAATCATTTCACTGGTTTCCTTCCACCTACCATTAGCCAACTCTCCAACTTAGAGTTCTTTTCTGCCTGTGATAATTCTTTCACTGGATCTATCCCTTCATCTTTATTCAACATTTCTTCATTGACCACCCTTGGTTTGAGTTATAACCAACTCAATGACACCACCAATATAAAGAATATCTCTTTGTTACATAATCTACAAAGATTATTACTTGACAACAACAATTTCAAGGCAAGTCAAGTTGACTTAGATGTCTTCTTGTCTCTTAAGCGTCTAGTCTCATTAGCTCTCTCAGGAATCCCTCTTTCAACAACAAACATCACTTCTGATTCAGAGTTTTCATCGCATTTGGAATACTTAGAATTGTCAGGCTGCAACATCATTGAGTTCCCTGAGTTTATAAGAAACCAAAGAAATCTATCTTCTATAGACCTTTCCAACAACAATATCAAAGGTCAAGTACCAAACTGGTTATGGAGACTACCAGAGTTGTCTACTGTGGATCTTTCGAACAACTCTCTCATCGGTTTCAACGGATCTTTAAAAGCTCTAAGTGGAAGTAAGATCGTGATGTTAGATCTTAGTTCCAATGCTTTTCAAGGACCACTCTTCATGCCACCCCGAGGCATCCAATATTTTCTTGGCTCTTACAATAACTTCACCGGATATATACCTCCCTCAATATGTGGACTAGCTAATCCACTTATCCTAGACCTATCAAACAACAATCTCCACGGCTTGATTCCTCGGTGTTTGGAGGCTCAGATGAGTTCTCTTTCAGTTCTGAATCTCCGTAACAATAGCCTCGATGGAAGTCTTCCTAATATATTTATGAACGCCAAGGTGTTAAGTTCACTTGACGTCAGTCACAACACTTTGGAGGGAAAGCTTCCCGCTTCTCTTGCCGGTTGCTCTGCTCTAGAGATTCTAAACGTGGAAAGCAACAATATCAACGATACTTTCCCGTTCTGGTTGAATTCTTTGCCGAAGCTACAAGTTCTTGTTCTCCGCTCTAATAACTTCCGTGGCACGTTACACAATGTTGATGGGGTTTGGTTTGGATTTCCTCTGTTACGAATCACTGATGTATCACACAACGACTTCGTCGGAACATTACCATCTGATTACTTCATGAATTGGACTGCGATCTCGAAGAGTGAAACAGAGCTGCAATACATTGGAGATCCTGAAGACTATGGCTACTACACTTCACTTGTCTTGATGAATAAAGGAGTATCAATGGAGATGCAACGTATCCTCACAAAATACACTGTCATTGATTTTGCTGGAAATAAGATCCAAGGAAAAATTCCAGAATCTGTTGGTATCTTGAAAGAACTTCATGTTCTTAATCTTTCGAGCAATGCTTTCACGGGCCACATCCCATCTTCTTTGGCAAACCTGACGAATCTGGAGTCACTAGACATATCCCAAAACAAGATTGGTGGTGAGATTCCTCCAGAACTCGGGACTCTCTCTTCTCTTGAGTGGATAAATGTTTCACATAATCAGCTAGTAGGTTCCATACCACAAGGCACACAGTTTCATCGACAGAATTGCTCCTCTTACGAGGGAAACCCCGGAATATACGGATCTTCTCTTAAGGATGTTTGTGGAGATATCCACGCGCCTAGACCACCACAAGCCGTACTGCCTCATTCATCATCATCATCATCAGAAGAAGATGAATTGATAAGTTGGATAGCAGCATGTTTAGGTTTTGCACCTGGAATGGTATTTGGTCTTACGATGGGATACATAATGACTTCACACAAGCATGAGTGGTTCATGGATACTTTTGGCCGAAGAAAAGGCCGGAGCACGAGAACTCGTTAG


Protein sequences

Name Description Sequence
disease resistance protein, putative disease resistance protein, putative [Arabidopsis thaliana].

MTGLYSSMSFFLRTIVLLFSTSSFCNTFASLTQDSCHPDQRDALLEFKNEFKIWYPNGFLDIDGVLMDVTSYPKTKSWTKNSDCCYWDGITCDTKSGKVTGLDLSCSCLHGRLEPNSSLFRLQHLQSVNLAYNNFTNSPIPAEFSKFMRLERLNLSRSSFSGHISIKLLQLTNLVSLDLSSSFPYSPSSLSIEKPLFLHLLALNFMNLRELDMSSVDISSAIPIEFSYMWSLRSLTLKGCNLLGRFPNSVLLIPNLESISLDHNLNLEGSLPNFLRNNSLLKLSIYNTSFSGTIPNSISNLKHLTSLKLQQSAFSGRIPSSLRSLSHLSNLVLSENNFVGEIPSSVSNLKQLTLFDVSDNNLNGNFPSSLLNLNQLRYIDICSNHFTGFLPPTISQLSNLEFFSACDNSFTGSIPSSLFNISSLTTLGLSYNQLNDTTNIKNISLLHNLQRLLLDNNNFKASQVDLDVFLSLKRLVSLALSGIPLSTTNITSDSEFSSHLEYLELSGCNIIEFPEFIRNQRNLSSIDLSNNNIKGQVPNWLWRLPELSTVDLSNNSLIGFNGSLKALSGSKIVMLDLSSNAFQGPLFMPPRGIQYFLGSYNNFTGYIPPSICGLANPLILDLSNNNLHGLIPRCLEAQMSSLSVLNLRNNSLDGSLPNIFMNAKVLSSLDVSHNTLEGKLPASLAGCSALEILNVESNNINDTFPFWLNSLPKLQVLVLRSNNFRGTLHNVDGVWFGFPLLRITDVSHNDFVGTLPSDYFMNWTAISKSETELQYIGDPEDYGYYTSLVLMNKGVSMEMQRILTKYTVIDFAGNKIQGKIPESVGILKELHVLNLSSNAFTGHIPSSLANLTNLESLDISQNKIGGEIPPELGTLSSLEWINVSHNQLVGSIPQGTQFHRQNCSSYEGNPGIYGSSLKDVCGDIHAPRPPQAVLPHSSSSSSEEDELISWIAACLGFAPGMVFGLTMGYIMTSHKHEWFMDTFGRRKGRSTRTR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF917
1-975 PTHR24420:SF917

MTGLYSSMSFFLRTIVLLFSTSSFCNTFASLTQDSCHPDQRDALLEFKNEFKIWYPNGFLDIDGVLMDVTSYPKTKSWTKNSDCCYWDGITCDTKSGKVTGLDLSCSCLHGRLEPNSSLFRLQHLQSVNLAYNNFTNSPIPAEFSKFMRLERLNLSRSSFSGHISIKLLQLTNLVSLDLSSSFPYSPSSLSIEKPLFLHLLALNFMNLRELDMSSVDISSAIPIEFSYMWSLRSLTLKGCNLLGRFPNSVLLIPNLESISLDHNLNLEGSLPNFLRNNSLLKLSIYNTSFSGTIPNSISNLKHLTSLKLQQSAFSGRIPSSLRSLSHLSNLVLSENNFVGEIPSSVSNLKQLTLFDVSDNNLNGNFPSSLLNLNQLRYIDICSNHFTGFLPPTISQLSNLEFFSACDNSFTGSIPSSLFNISSLTTLGLSYNQLNDTTNIKNISLLHNLQRLLLDNNNFKASQVDLDVFLSLKRLVSLALSGIPLSTTNITSDSEFSSHLEYLELSGCNIIEFPEFIRNQRNLSSIDLSNNNIKGQVPNWLWRLPELSTVDLSNNSLIGFNGSLKALSGSKIVMLDLSSNAFQGPLFMPPRGIQYFLGSYNNFTGYIPPSICGLANPLILDLSNNNLHGLIPRCLEAQMSSLSVLNLRNNSLDGSLPNIFMNAKVLSSLDVSHNTLEGKLPASLAGCSALEILNVESNNINDTFPFWLNSLPKLQVLVLRSNNFRGTLHNVDGVWFGFPLLRITDVSHNDFVGTLPSDYFMNWTAISKSETELQYIGDPEDYGYYTSLVLMNKGVSMEMQRILTKYTVIDFAGNKIQGKIPESVGILKELHVLNLSSNAFTGHIPSSLANLTNLESLDISQNKIGGEIPPELGTLSSLEWINVSHNQLVGSIPQGTQFHRQNCSSYEGNPGIYGSSLKDVCGDIHAPRPPQAVLPHSSSSSSEEDELISWIAACLGFAPGMVFGLTMGYIMTSHK

HMMPanther: PTHR24420
1-975 PTHR24420,FAMILY NOT NAMED

MTGLYSSMSFFLRTIVLLFSTSSFCNTFASLTQDSCHPDQRDALLEFKNEFKIWYPNGFLDIDGVLMDVTSYPKTKSWTKNSDCCYWDGITCDTKSGKVTGLDLSCSCLHGRLEPNSSLFRLQHLQSVNLAYNNFTNSPIPAEFSKFMRLERLNLSRSSFSGHISIKLLQLTNLVSLDLSSSFPYSPSSLSIEKPLFLHLLALNFMNLRELDMSSVDISSAIPIEFSYMWSLRSLTLKGCNLLGRFPNSVLLIPNLESISLDHNLNLEGSLPNFLRNNSLLKLSIYNTSFSGTIPNSISNLKHLTSLKLQQSAFSGRIPSSLRSLSHLSNLVLSENNFVGEIPSSVSNLKQLTLFDVSDNNLNGNFPSSLLNLNQLRYIDICSNHFTGFLPPTISQLSNLEFFSACDNSFTGSIPSSLFNISSLTTLGLSYNQLNDTTNIKNISLLHNLQRLLLDNNNFKASQVDLDVFLSLKRLVSLALSGIPLSTTNITSDSEFSSHLEYLELSGCNIIEFPEFIRNQRNLSSIDLSNNNIKGQVPNWLWRLPELSTVDLSNNSLIGFNGSLKALSGSKIVMLDLSSNAFQGPLFMPPRGIQYFLGSYNNFTGYIPPSICGLANPLILDLSNNNLHGLIPRCLEAQMSSLSVLNLRNNSLDGSLPNIFMNAKVLSSLDVSHNTLEGKLPASLAGCSALEILNVESNNINDTFPFWLNSLPKLQVLVLRSNNFRGTLHNVDGVWFGFPLLRITDVSHNDFVGTLPSDYFMNWTAISKSETELQYIGDPEDYGYYTSLVLMNKGVSMEMQRILTKYTVIDFAGNKIQGKIPESVGILKELHVLNLSSNAFTGHIPSSLANLTNLESLDISQNKIGGEIPPELGTLSSLEWINVSHNQLVGSIPQGTQFHRQNCSSYEGNPGIYGSSLKDVCGDIHAPRPPQAVLPHSSSSSSEEDELISWIAACLGFAPGMVFGLTMGYIMTSHK

HMMPfam: PF08263
IPR013210
38-93 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQRDALLEFKNEFKIWYPNGFLDIDGVLMDVTSYPKTKSWTKNSDCCYWDGITCD

Gene3D: G3DSA:3.80.10.10
74-301 G3DSA:3.80.10.10

KTKSWTKNSDCCYWDGITCDTKSGKVTGLDLSCSCLHGRLEPNSSLFRLQHLQSVNLAYNNFTNSPIPAEFSKFMRLERLNLSRSSFSGHISIKLLQLTNLVSLDLSSSFPYSPSSLSIEKPLFLHLLALNFMNLRELDMSSVDISSAIPIEFSYMWSLRSLTLKGCNLLGRFPNSVLLIPNLESISLDHNLNLEGSLPNFLRNNSLLKLSIYNTSFSGTIPNSISNL

superfamily: SSF52047
78-343 SSF52047,LRR

WTKNSDCCYWDGITCDTKSGKVTGLDLSCSCLHGRLEPNSSLFRLQHLQSVNLAYNNFTNSPIPAEFSKFMRLERLNLSRSSFSGHISIKLLQLTNLVSLDLSSSFPYSPSSLSIEKPLFLHLLALNFMNLRELDMSSVDISSAIPIEFSYMWSLRSLTLKGCNLLGRFPNSVLLIPNLESISLDHNLNLEGSLPNFLRNNSLLKLSIYNTSFSGTIPNSISNLKHLTSLKLQQSAFSGRIPSSLRSLSHLSNLVLSENNFVGEIP

superfamily: SSF52047
278-558 SSF52047,LRR

NSLLKLSIYNTSFSGTIPNSISNLKHLTSLKLQQSAFSGRIPSSLRSLSHLSNLVLSENNFVGEIPSSVSNLKQLTLFDVSDNNLNGNFPSSLLNLNQLRYIDICSNHFTGFLPPTISQLSNLEFFSACDNSFTGSIPSSLFNISSLTTLGLSYNQLNDTTNIKNISLLHNLQRLLLDNNNFKASQVDLDVFLSLKRLVSLALSGIPLSTTNITSDSEFSSHLEYLELSGCNIIEFPEFIRNQRNLSSIDLSNNNIKGQVPNWLWRLPELSTVDLSNNSLI

Gene3D: G3DSA:3.80.10.10
302-476 G3DSA:3.80.10.10

KHLTSLKLQQSAFSGRIPSSLRSLSHLSNLVLSENNFVGEIPSSVSNLKQLTLFDVSDNNLNGNFPSSLLNLNQLRYIDICSNHFTGFLPPTISQLSNLEFFSACDNSFTGSIPSSLFNISSLTTLGLSYNQLNDTTNIKNISLLHNLQRLLLDNNNFKASQVDLDVFLSLKRLV

Gene3D: G3DSA:3.80.10.10
477-635 G3DSA:3.80.10.10

SLALSGIPLSTTNITSDSEFSSHLEYLELSGCNIIEFPEFIRNQRNLSSIDLSNNNIKGQVPNWLWRLPELSTVDLSNNSLIGFNGSLKALSGSKIVMLDLSSNAFQGPLFMPPRGIQYFLGSYNNFTGYIPPSICGLANPLILDLSNNNLHGLIPRCL

HMMPfam: PF13855
498-557 LRR_8,Leucine rich repeat

SHLEYLELSGCNIIEFPEFIRNQRNLSSIDLSNNNIKGQVPNWLWRLPELSTVDLSNNSL

FPrintScan: PR00019
523-536 LEURICHRPT,Leucine-rich repeat signature

LSSIDLSNNNIKGQ

superfamily: SSF52047
575-895 SSF52047,LRR

LDLSSNAFQGPLFMPPRGIQYFLGSYNNFTGYIPPSICGLANPLILDLSNNNLHGLIPRCLEAQMSSLSVLNLRNNSLDGSLPNIFMNAKVLSSLDVSHNTLEGKLPASLAGCSALEILNVESNNINDTFPFWLNSLPKLQVLVLRSNNFRGTLHNVDGVWFGFPLLRITDVSHNDFVGTLPSDYFMNWTAISKSETELQYIGDPEDYGYYTSLVLMNKGVSMEMQRILTKYTVIDFAGNKIQGKIPESVGILKELHVLNLSSNAFTGHIPSSLANLTNLESLDISQNKIGGEIPPELGTLSSLEWINVSHNQLVGSIPQG

Gene3D: G3DSA:3.80.10.10
638-768 G3DSA:3.80.10.10

QMSSLSVLNLRNNSLDGSLPNIFMNAKVLSSLDVSHNTLEGKLPASLAGCSALEILNVESNNINDTFPFWLNSLPKLQVLVLRSNNFRGTLHNVDGVWFGFPLLRITDVSHNDFVGTLPSDYFMNWTAISK

HMMPfam: PF13855
666-724 LRR_8,Leucine rich repeat

LSSLDVSHNTLEGKLPASLAGCSALEILNVESNNINDTFPFWLNSLPKLQVLVLRSNNF

Gene3D: G3DSA:3.80.10.10
809-911 G3DSA:3.80.10.10

IDFAGNKIQGKIPESVGILKELHVLNLSSNAFTGHIPSSLANLTNLESLDISQNKIGGEIPPELGTLSSLEWINVSHNQLVGSIPQGTQFHRQNCSSYEGNPG

HMMPfam: PF13855
829-888 LRR_8,Leucine rich repeat

ELHVLNLSSNAFTGHIPSSLANLTNLESLDISQNKIGGEIPPELGTLSSLEWINVSHNQL

FPrintScan: PR00019
851-864 LEURICHRPT,Leucine-rich repeat signature

LTNLESLDISQNKI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox