PRGDB00047523 (OSJNBa0079L16.20)

From PRG Wiki
Jump to: navigation, search
OSJNBa0079L16.20
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 10716598 (AC026815)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 10 BAC OSJNBa0079L16 genomic sequence, complete sequence.

DNA Sequence

TGATTCGGTGAAAGAGATTGCGGGGGAGGTGGATGGAGCTCGAGCTCCTCCTCGGCATGGCGCTGCGAGCGCCTGCGATCGCGGAGGGGACGATGCGATGCGTAGGCGTGGCTCGTGTAGGCGATGAGAAAAGAGAGGGTAAAGGAGACTCATCGCGTGTAGAAGATGCTGGTCACCTCAATTTCGGACGAAGGCCGGGTCTCAGGTGCGGCGAGTTCTCGCGAATTGGCGGAGGCGGTGAGGTTAGGGTTTCGCCTGGTTTGCGGATGGCGACGGCGGTGGAGGAGGCGAAGTGTTGTGCGGCTCTTGGGCGGAGATGGCCCCCGTCGTCCACCCTTTCTTCCTCCTCCCCCTCCTCGTGGCGATCGCTTCCATCCCAGGATCAGTCAATGCCGCAGCATCGTCCCAGCAGACCGACGCGCTACTGGCATGGAAGTCGAGCCTCGCTGACCCGGTCGCGCTGTCCGGCTGGACGCGGGCTTCGCCGGTCTGCACCTGGCGCGGCGTGGGCTGCGACGCCGCCGGCGGCGGCCGCGTCACGAAGCTGCGCCTCCGGGGACTGGGACTCGGCGGCGGCCTCCACACGCTCGAGCTCGACTTCGCCGCGTTCCCGGCGCTCACCGAGCTCGACCTCAACGGGAACAGCTTCGCCGGCGACATCCCGGCCGGCATCTCGCAACTGCGCTCCCTTGCCTCGCTCGACCTCGGCGACAACGGGTTCAACGGCTCCATCCCGCCGCAGATCGGCCACCTCTCCGGCCTCGTCGACCTCTGCCTCTACAACAACAACCTCGTTGGCGCCATCCCGCACCAGCTCAGCCGACTCCCCAAGATTGCCCACTTCGACCTGGGAGCAAACTACCTGACCGACCAGGACTTCGCCAAGTTCTCGCCGATGCCCACCGTGACATTCATGTCGCTCTACGACAACTCCATCAATGGTAGCTTCCCGGACTTCATCCTCAAGAGCGGCAACATCACCTACCTCGACTTGTCGCAGAATACTCTGTTCGGGCTGATGCCGGACACACTGCCGGAGAAGCTCCCGAATCTGATGTACCTGAACTTGTCCAACAATGAATTCTCTGGCCGGATTCCGGCGTCGCTCAGGAGGTTAACGAAGCTCCAGGACCTGCTGATTGCCGCCAACAATCTCACCGGCGGCGTCCCAGAGTTCCTTGGGTCGATGTCACAGTTGAGGATTCTCGAACTTGGTGACAACCAGCTCGGCGGGGCGATCCCGCCGGTTCTTGGCCAGCTCCAGATGCTGCAGCGGCTCAAGATAAAGAACGCTGGGCTTGTTTCAACTCTGCCGCCGGAGCTGGGAAATCTTAAGAATCTCACTTTTCTAGAGATATCCGTGAACCACCTCTCCGGTGGCTTGCCCCCGGCATTCGCCGGGATGTGCGCAATGCGGGAGTTCGGACTTGAAATGAACGGGCTCACCGGTGAGATCCCTTCGGTGTTGTTCACGAGCTGGCCCGAGCTCATATCGTTCCAAGTACAGTACAACTTCTTCACTGGCAGGATTCCAAAAGAGGTCGGCATGGCGAGGAAACTGAAAATCCTTTACCTGTTCAGCAACAACCTTTGCGGATCCATCCCGGCAGAACTCGGCGATTTGGAGAATCTGGAAGAGCTGGATTTGTCAAACAACTTGCTGACCGGACCGATCCCTAGATCAATCGGCAACCTCAAGCAGCTTACGGCTTTGGCGTTGTTCTTCAACGATCTCACCGGTGTAATCCCACCTGAGATTGGCAACATGACAGCGTTGCAAAGGTTGGACGTCAACACCAACCGTCTGCAAGGCGAGCTCCCTGCCACCATCTCGTCCCTCAGGAACCTTCAGTACCTCTCCGTGTTCAACAACTACATGAGTGGCACCATCCCGCCGGACCTCGGCAAGGGCATAGCCTTGCAGCACGTGAGCTTCACCAACAACAGCTTCTCCGGTGAGCTGCCGCGCCACATCTGCGACGGCTTCGCGCTGGAGCGCTTCACGGCGAACCACAACAACTTCAGCGGCACGCTACCGCCATGTCTGAAGAACTGCACAAGCCTATACCGGGTGCGGCTGGACGGGAACCACTTCACCGGCGACATCTCAGATGCCTTCGGCATACACCCCAGCTTGGAATACTTGGACATATCCGGGAGCAAGCTCACCGGTCGGCTATCGTCTGACTGGGGACAGTGCACCAACCTCACATATCTGTCAATCAACGGTAACAGCATATCCGGCAACCTTGATTCGACCTTTTGTACATTGTCATCTCTTCAGTTTTTGGATCTATCAAATAACCGATTCAATGGTGAGCTCCCAAGGTGTTGGTGGGAGTTGCAAGCTTTGCTGTTTATGGACGTCTCTGGCAACGGCTTCTCGGGTGAATTGCCAGCATCAAGAAGCCCTGAACTTCCTCTCCAATCTCTGCATCTTGCTAACAATAGTTTCTCTGTAGTTTTCCCAGCCACCATTCGCAACTGCAGAGCACTTGTTACGCTTGATATGTGGAGCAACAAGTTCTTTGGCAAGATTCCCTCTTGGATAGGAACTAGTCTTCCTGTCCTAAGAATTCTTCTCCTCCGATCAAATAATTTCAGTGGAGAGATTCCCACAGAATTATCCCAACTTTCTCAGCTTCAACTTCTTGATTTGGCCAGCAATGGGTTAACTGGATTCATCCCAACAACTTTTGCCAACTTATCATCCATGAAACAAGCAAAAACCTTCCCCACAATAGGGACTTTTAATTGGAAAAGTGCCCCTTCAAGAGGATACGATTATCCGTTCCCTCTTGATCAGTCTAGAGACAGATTTAACATATTATGGAAGGGACATGAAGAAACTTTTCAAGGAACAGCTATGTTAATGACAGGAATTGATTTATCAAGCAATTCACTTTACGGTGAAATCCCAAAAGAGCTAACATACCTTCAGGGCCTCCG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa].

MAPVVHPFFLLPLLVAIASIPGSVNAAASSQQTDALLAWKSSLADPVALSGWTRASPVCTWRGVGCDAAGGGRVTKLRLRGLGLGGGLHTLELDFAAFPALTELDLNGNSFAGDIPAGISQLRSLASLDLGDNGFNGSIPPQIGHLSGLVDLCLYNNNLVGAIPHQLSRLPKIAHFDLGANYLTDQDFAKFSPMPTVTFMSLYDNSINGSFPDFILKSGNITYLDLSQNTLFGLMPDTLPEKLPNLMYLNLSNNEFSGRIPASLRRLTKLQDLLIAANNLTGGVPEFLGSMSQLRILELGDNQLGGAIPPVLGQLQMLQRLKIKNAGLVSTLPPELGNLKNLTFLEISVNHLSGGLPPAFAGMCAMREFGLEMNGLTGEIPSVLFTSWPELISFQVQYNFFTGRIPKEVGMARKLKILYLFSNNLCGSIPAELGDLENLEELDLSNNLLTGPIPRSIGNLKQLTALALFFNDLTGVIPPEIGNMTALQRLDVNTNRLQGELPATISSLRNLQYLSVFNNYMSGTIPPDLGKGIALQHVSFTNNSFSGELPRHICDGFALERFTANHNNFSGTLPPCLKNCTSLYRVRLDGNHFTGDISDAFGIHPSLEYLDISGSKLTGRLSSDWGQCTNLTYLSINGNSISGNLDSTFCTLSSLQFLDLSNNRFNGELPRCWWELQALLFMDVSGNGFSGELPASRSPELPLQSLHLANNSFSVVFPATIRNCRALVTLDMWSNKFFGKIPSWIGTSLPVLRILLLRSNNFSGEIPTELSQLSQLQLLDLASNGLTGFIPTTFANLSSMKQAKTFPTIGTFNWKSAPSRGYDYPFPLDQSRDRFNILWKGHEETFQGTAMLMTGIDLSSNSLYGEIPKELTYLQGLRKREGKGDSSRVEDAGHLNFGRRPGLRCGEFSRIGGGGEVRVSPGLRMATAVEEAKCCAALGRSDSVKEIAGEVDGARAPPRHGAASACDRGGDDAMRRRGSCRR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF504
10-791 PTHR24420:SF504,OS10G0469000 PROTEIN

LLPLLVAIASIPGSVNAAASSQQTDALLAWKSSLADPVALSGWTRASPVCTWRGVGCDAAGGGRVTKLRLRGLGLGGGLHTLELDFAAFPALTELDLNGNSFAGDIPAGISQLRSLASLDLGDNGFNGSIPPQIGHLSGLVDLCLYNNNLVGAIPHQLSRLPKIAHFDLGANYLTDQDFAKFSPMPTVTFMSLYDNSINGSFPDFILKSGNITYLDLSQNTLFGLMPDTLPEKLPNLMYLNLSNNEFSGRIPASLRRLTKLQDLLIAANNLTGGVPEFLGSMSQLRILELGDNQLGGAIPPVLGQLQMLQRLKIKNAGLVSTLPPELGNLKNLTFLEISVNHLSGGLPPAFAGMCAMREFGLEMNGLTGEIPSVLFTSWPELISFQVQYNFFTGRIPKEVGMARKLKILYLFSNNLCGSIPAELGDLENLEELDLSNNLLTGPIPRSIGNLKQLTALALFFNDLTGVIPPEIGNMTALQRLDVNTNRLQGELPATISSLRNLQYLSVFNNYMSGTIPPDLGKGIALQHVSFTNNSFSGELPRHICDGFALERFTANHNNFSGTLPPCLKNCTSLYRVRLDGNHFTGDISDAFGIHPSLEYLDISGSKLTGRLSSDWGQCTNLTYLSINGNSISGNLDSTFCTLSSLQFLDLSNNRFNGELPRCWWELQALLFMDVSGNGFSGELPASRSPELPLQSLHLANNSFSVVFPATIRNCRALVTLDMWSNKFFGKIPSWIGTSLPVLRILLLRSNNFSGEIPTELSQLSQLQLLDLASNGLTGFIP

HMMPanther: PTHR24420
10-791 PTHR24420,FAMILY NOT NAMED

LLPLLVAIASIPGSVNAAASSQQTDALLAWKSSLADPVALSGWTRASPVCTWRGVGCDAAGGGRVTKLRLRGLGLGGGLHTLELDFAAFPALTELDLNGNSFAGDIPAGISQLRSLASLDLGDNGFNGSIPPQIGHLSGLVDLCLYNNNLVGAIPHQLSRLPKIAHFDLGANYLTDQDFAKFSPMPTVTFMSLYDNSINGSFPDFILKSGNITYLDLSQNTLFGLMPDTLPEKLPNLMYLNLSNNEFSGRIPASLRRLTKLQDLLIAANNLTGGVPEFLGSMSQLRILELGDNQLGGAIPPVLGQLQMLQRLKIKNAGLVSTLPPELGNLKNLTFLEISVNHLSGGLPPAFAGMCAMREFGLEMNGLTGEIPSVLFTSWPELISFQVQYNFFTGRIPKEVGMARKLKILYLFSNNLCGSIPAELGDLENLEELDLSNNLLTGPIPRSIGNLKQLTALALFFNDLTGVIPPEIGNMTALQRLDVNTNRLQGELPATISSLRNLQYLSVFNNYMSGTIPPDLGKGIALQHVSFTNNSFSGELPRHICDGFALERFTANHNNFSGTLPPCLKNCTSLYRVRLDGNHFTGDISDAFGIHPSLEYLDISGSKLTGRLSSDWGQCTNLTYLSINGNSISGNLDSTFCTLSSLQFLDLSNNRFNGELPRCWWELQALLFMDVSGNGFSGELPASRSPELPLQSLHLANNSFSVVFPATIRNCRALVTLDMWSNKFFGKIPSWIGTSLPVLRILLLRSNNFSGEIPTELSQLSQLQLLDLASNGLTGFIP

Gene3D: G3DSA:3.80.10.10
30-239 G3DSA:3.80.10.10

SQQTDALLAWKSSLADPVALSGWTRASPVCTWRGVGCDAAGGGRVTKLRLRGLGLGGGLHTLELDFAAFPALTELDLNGNSFAGDIPAGISQLRSLASLDLGDNGFNGSIPPQIGHLSGLVDLCLYNNNLVGAIPHQLSRLPKIAHFDLGANYLTDQDFAKFSPMPTVTFMSLYDNSINGSFPDFILKSGNITYLDLSQNTLFGLMPDTL

HMMPfam: PF08263
IPR013210
30-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SQQTDALLAWKSSLADPVALSGWTRASPVCTWRGVGCD

superfamily: SSF52047
76-328 SSF52047,LRR

KLRLRGLGLGGGLHTLELDFAAFPALTELDLNGNSFAGDIPAGISQLRSLASLDLGDNGFNGSIPPQIGHLSGLVDLCLYNNNLVGAIPHQLSRLPKIAHFDLGANYLTDQDFAKFSPMPTVTFMSLYDNSINGSFPDFILKSGNITYLDLSQNTLFGLMPDTLPEKLPNLMYLNLSNNEFSGRIPASLRRLTKLQDLLIAANNLTGGVPEFLGSMSQLRILELGDNQLGGAIPPVLGQLQMLQRLKIKNAGL

HMMPfam: PF00560
IPR001611
101-122 LRR_1
Leucine-rich repeat

LTELDLNGNSFAGDIPAGISQL

HMMPfam: PF13855
220-280 LRR_8,Leucine rich repeat

NITYLDLSQNTLFGLMPDTLPEKLPNLMYLNLSNNEFSGRIPASLRRLTKLQDLLIAANNL

FPrintScan: PR00019
221-234 LEURICHRPT,Leucine-rich repeat signature

ITYLDLSQNTLFGL

Gene3D: G3DSA:3.80.10.10
242-398 G3DSA:3.80.10.10

KLPNLMYLNLSNNEFSGRIPASLRRLTKLQDLLIAANNLTGGVPEFLGSMSQLRILELGDNQLGGAIPPVLGQLQMLQRLKIKNAGLVSTLPPELGNLKNLTFLEISVNHLSGGLPPAFAGMCAMREFGLEMNGLTGEIPSVLFTSWPELISFQVQY

superfamily: SSF52047
331-642 SSF52047,LRR

TLPPELGNLKNLTFLEISVNHLSGGLPPAFAGMCAMREFGLEMNGLTGEIPSVLFTSWPELISFQVQYNFFTGRIPKEVGMARKLKILYLFSNNLCGSIPAELGDLENLEELDLSNNLLTGPIPRSIGNLKQLTALALFFNDLTGVIPPEIGNMTALQRLDVNTNRLQGELPATISSLRNLQYLSVFNNYMSGTIPPDLGKGIALQHVSFTNNSFSGELPRHICDGFALERFTANHNNFSGTLPPCLKNCTSLYRVRLDGNHFTGDISDAFGIHPSLEYLDISGSKLTGRLSSDWGQCTNLTYLSINGNSIS

Gene3D: G3DSA:3.80.10.10
399-612 G3DSA:3.80.10.10

NFFTGRIPKEVGMARKLKILYLFSNNLCGSIPAELGDLENLEELDLSNNLLTGPIPRSIGNLKQLTALALFFNDLTGVIPPEIGNMTALQRLDVNTNRLQGELPATISSLRNLQYLSVFNNYMSGTIPPDLGKGIALQHVSFTNNSFSGELPRHICDGFALERFTANHNNFSGTLPPCLKNCTSLYRVRLDGNHFTGDISDAFGIHPSLEYLDI

HMMPfam: PF00560
IPR001611
414-435 LRR_1
Leucine-rich repeat

KLKILYLFSNNLCGSIPAELGD

FPrintScan: PR00019
436-449 LEURICHRPT,Leucine-rich repeat signature

LENLEELDLSNNLL

HMMPfam: PF00560
IPR001611
438-460 LRR_1
Leucine-rich repeat

NLEELDLSNNLLTGPIPRSIGNL

superfamily: SSF52047
555-888 SSF52047,LRR

DGFALERFTANHNNFSGTLPPCLKNCTSLYRVRLDGNHFTGDISDAFGIHPSLEYLDISGSKLTGRLSSDWGQCTNLTYLSINGNSISGNLDSTFCTLSSLQFLDLSNNRFNGELPRCWWELQALLFMDVSGNGFSGELPASRSPELPLQSLHLANNSFSVVFPATIRNCRALVTLDMWSNKFFGKIPSWIGTSLPVLRILLLRSNNFSGEIPTELSQLSQLQLLDLASNGLTGFIPTTFANLSSMKQAKTFPTIGTFNWKSAPSRGYDYPFPLDQSRDRFNILWKGHEETFQGTAMLMTGIDLSSNSLYGEIPKELTYLQGLRKREGKGDSSR

HMMPfam: PF13855
605-665 LRR_8,Leucine rich repeat

PSLEYLDISGSKLTGRLSSDWGQCTNLTYLSINGNSISGNLDSTFCTLSSLQFLDLSNNRF

Gene3D: G3DSA:3.80.10.10
613-799 G3DSA:3.80.10.10

SGSKLTGRLSSDWGQCTNLTYLSINGNSISGNLDSTFCTLSSLQFLDLSNNRFNGELPRCWWELQALLFMDVSGNGFSGELPASRSPELPLQSLHLANNSFSVVFPATIRNCRALVTLDMWSNKFFGKIPSWIGTSLPVLRILLLRSNNFSGEIPTELSQLSQLQLLDLASNGLTGFIPTTFANLSS

Gene3D: G3DSA:3.80.10.10
853-878 G3DSA:3.80.10.10

MTGIDLSSNSLYGEIPKELTYLQGLR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox