PRGDB00047529 (T6K12.30)

From PRG Wiki
Jump to: navigation, search
T6K12.30
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12408745 (AC016829)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome III BAC T6K12 genomic sequence, complete sequence.

DNA Sequence

ATGGTTTATAGAAAATTCAGGTTACACCAAGAGAAGAACAACATATCATCTTGTTTTTCTTTTTCATCTTGCTTTTCTTTTTCATCTTCTTCATCGACTTCGTCGCCCGGTCGTAAACACCAAGTCTTTCCAAGTTTCCACGGGGCAGATGTACGCAAATCCTTTCTCAGCCACATCATGAAGGAGTTCAAAAGCAAGGGAATCGACATATTCATTGATAAAGATATCAAGAGGGGTAAGTCCATCGGTCCTGAGCTCACAGAAGCTATCAGAGGATCGAGGGTTGCGATTGTCTTCCTCTCGAGGAAATATGCTTCTTCGTCGTGGTGCCTGAATGAGTTGGCACTGATCATGAAGTGCAGAAAAGAGTTGGGTCTAACAGTGATGACCCTTTTCTATGACTTGGACCCAACTGATGTAAGGAAGCAGACCGGAGATTTTGGGATGGCCTTCAAAGAAACTTGTAAAGGTAAAACAAAGGATGAAATTGGAAGATGGAGACATGCTTTGGAGGAAGTCGCCAAAATCGCCGGTTACCATTCAAGCATATGGGATAATGAAGCGGACATGATCGGAATAGTCACCACTGATATTTCAAATACGTTGAACATCTCAACGCCGTCAAGTGATTTCAGCGACTTAGTTGGGATGGAGGATCATATGAAAAAATTGGAACGAATGTTATACCTAGATCTGAATGATGTGAGGATGATAGGGATTTGGGGTCCTCCTGGGATTGGTAAGACTTCCATCGCCAGAGTTTTATTTCGAAAACATTCTGACAGTTTCGATTTGAGTGTCTTTATGGAGACTGTCAAGGGTTATACAAGACCAGGTTGTTCGGATGAACACGGTCTTAAGCTGCACTTACAGCAGCAGTTTCTGTCTCAAATATTCAACCAGAAGGATGTAGAAGTTCCTCACTTAGGAGTTGTACAAGACAGGTTAAGAGACAAGAGAGTGCTTGTTGTGCTTGATGACGTTGATCAGTCAGCACAATTAGAAGCCATGGCCAAGGAAAATAAGTGGTTTGGTCCTGGAAGTCGGATTATCATCACCACGCAAGATCGAAGACTTTTGAAAGCACATGGAATCAAAGATGTGTACAAGGTGGATTTACCACCACCTGATGATGCTTTTCAAATCTTCTGCATGTATGCTTTTGGTAAAACCTCTCCAAAACATGGTTTCGAGGAGCTTGCATGGGAAGCTACATACCTTTCTGGTATACACCCTTCGGGAATAAAAAGTATGGGCTCTTATTTCCGGAAAATGTCAAAACCGGAGTGGGTAAACGCGTTACAAAGGTTAAGGACTAGTAAGCTTGACTCTGAATCTCCGAGGACCCACAGAAAGCTCATAAATAGATTAAGGAATGTAAAACAGAAGATGCTGTCAAATACGTTGAGCCGTATAAGGAAGCACCAAATAGCATCAGCAGCAGCAAAAGCTGCTAGTGTTTATGAAACAAGTATAAAAGAAGAGGTGGATTCGTCCGCGGAGTCGTTGAATCATTGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MVYRKFRLHQEKNNISSCFSFSSCFSFSSSSSTSSPGRKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGYHSSIWDNEADMIGIVTTDISNTLNISTPSSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRIIITTQDRRLLKAHGIKDVYKVDLPPPDDAFQIFCMYAFGKTSPKHGFEELAWEATYLSGIHPSGIKSMGSYFRKMSKPEWVNALQRLRTSKLDSESPRTHRKLINRLRNVKQKMLSNTLSRIRKHQIASAAAKAASVYETSIKEEVDSSAESLNH

Domains

Domain Start-End Description Sequence

ProfileScan: PS51257
1-24 PROKAR_LIPOPROTEIN,Prokaryotic membrane lipoprotein lipid attachment site profile.

MVYRKFRLHQEKNNISSCFSFSSC

superfamily: SSF52200
IPR000157
28-179 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSTSSPGRKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGY

Gene3D: G3DSA:3.40.50.10140
37-175 G3DSA:3.40.50.10140

GRKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAK

ProfileScan: PS50104
IPR000157
38-176 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKI

HMMSmart: SM00255
IPR000157
39-176 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKI

HMMPfam: PF01582
IPR000157
42-171 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALE

HMMPanther: PTHR23155
50-350 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGYHSSIWDNEADMIGIVTTDISNTLNISTPSSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRI

HMMPanther: PTHR23155:SF296
50-350 PTHR23155:SF296

DVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGYHSSIWDNEADMIGIVTTDISNTLNISTPSSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRI

superfamily: SSF52540
93-440 SSF52540

SRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGYHSSIWDNEADMIGIVTTDISNTLNISTPSSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRIIITTQDRRLLKAHGIKDVYKVDLPPPDDAFQIFCMYAFGKTSPKHGFEELAWEATYLSGIHPSGIKSMGSYFRKMSKPEWVNALQRLRTS

Gene3D: G3DSA:3.40.50.300
208-246 G3DSA:3.40.50.300

SSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGI

HMMPfam: PF00931
IPR002182
218-446 NB-ARC,NBS
NB-ARC

EDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRIIITTQDRRLLKAHGIKDVYKVDLPPPDDAFQIFCMYAFGKTSPKHGFEELAWEATYLSGIHPSGIKSMGSYFRKMSKPEWVNALQRLRTSKLDSES

FPrintScan: PR00364
IPR000767
237-252 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTSIA

Gene3D: G3DSA:3.40.50.300
247-265 G3DSA:3.40.50.300

GKTSIARVLFRKHSDSFDL

Gene3D: G3DSA:3.40.50.300
291-357 G3DSA:3.40.50.300

QQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRIIITTQDR

FPrintScan: PR00364
IPR000767
315-329 DISEASERSIST
Disease resistance protein

RLRDKRVLVVLDDVD

Gene3D: G3DSA:3.40.50.300
403-422 G3DSA:3.40.50.300

EATYLSGIHPSGIKSMGSYF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox