PRGDB00047531 (F18C1.20)

From PRG Wiki
Jump to: navigation, search
F18C1.20
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12408732 (AC011620)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome III BAC F18C1 genomic sequence, complete sequence.

DNA Sequence

ATGAAAGACTCTTGGAACTCAACGAGTATCATTCCTTTCACTTTTTCTTCTCTCATATTCTTCTTATTCACTTTTGATTTTCAAGATGTCTTTGGGGTTCCTACTAAACACTTATGTCGTCTCGAACAAAGAGATGCACTACTGGAGCTCAAGAAGGAGTTTAAGATTAAGAAGCCTTGTTTCGACGGCCTTCATCCGACGACGGAGTCATGGGCGAATAACAGTGACTGTTGCTATTGGGACGGTATCACGTGCAATGACAAGTCCGGGGAAGTGCTTGAGCTAGACCTTAGTCGTAGCTGCCTCCAAAGCCGGTTTCATTCCAACAGCAGTCTTTTTACGGTTCTAAATCTTCGTTTTCTAACCACTCTCGACCTTTCCTATAATTATTTCAGTGGCCAAATCCCGTCTTGTATTGAAAACTTTTCTCATCTTACCACTCTCGACCTTTCTAAAAACTATTTCAGTGGTGGGATTCCTTCTTCAATAGGAAATCTTTCACAACTCACTTTTCTCGACCTTTCTGGTAACGAGTTCGTTGGTGAAATGCCATTTTTTGGCAACATGAACCAGTTGACCAACTTATATGTTGATTCCAATGACCTTACTGGTATCTTCCCCCTTTCCCTACTCAATCTGAAACATCTTTCGGATTTATCACTCTCCCGCAATCAGTTCACAGGTACCCTTCCTTCTAACATGAGCTCACTCTCTAACTTGGAGTACTTTGAGGCATGGGGCAACGCTTTTACTGGAACTCTCCCTTCTTCTCTCTTCACTATTGCTTCTTTGACGTCTATTAATTTGAGAAATAACCAACTCAACGGCACTCTTGAGTTTGGGAACATATCTTCACCATCTACACTAACTGTGTTAGACATTAGCAATAACAACTTCATAGGGCCAATCCCGAAATCCATTTCCAAATTTATAAACCTTCAGGACCTTGATCTTTCTCATCTCAACACCCAAGGCCCAGTTGACTTTAGTATCTTCACGAATCTCAAGTCGCTCCAACTTCTTAACCTATCTCATTTGAACACCACCACTACGATTGACTTGAATGCACTCTTTTCCTCGCATCTCAACTCAATCTATTCAATGGATCTCTCAGGCAACCATGTTTCAGCCACAACCAAAATTTCAGTTGCAGATCATCATCCTACGCAATTGATAAGTCAGTTGTACTTGTCTGGATGCGGCATCACTGAGTTCCCGGAGCTCTTAAGAAGCCAACACAAAATGACGAATCTAGACATTTCCAACAACAAAATCAAAGGTCAGGTGCCTGGCTGGCTATGGACACTACCAAAGTTGATATTCGTTGATCTTTCCAACAACATTTTTACCGGTTTTGAAAGATCAACGGAACATGGACTATCCTTAATCACCAAACCATCTATGCAGTACTTGGTTGGCTCCAACAACAATTTCACGGGAAAGATTCCCTCTTTCATATGCGCTTTGCGCTCTCTAATCACTCTTGATTTATCTGACAACAACCTCAATGGTTCCATCCCTCCATGTATGGGAAACCTTAAGAGTACTCTTTCATTTCTAAACCTTCGTCAGAATCGTCTTGGTGGAGGTCTTCCAAGGAGTATATTTAAAAGTCTAAGGTCACTTGATGTCGGTCATAACCAACTAGTCGGAAAACTTCCTAGATCTTTCATCCGTCTCTCTGCTCTTGAAGTTCTGAATGTGGAAAACAACAGAATCAACGACACATTCCCGTTCTGGTTGTCTTCTCTCAAAAAGCTGCAAGTTCTTGTCTTACGCTCCAATGCATTCCACGGACCGATACATCATGCCTCGTTCCATACATTGCGAATCATCAACTTATCTCATAATCAATTCAGTGGAACTTTGCCAGCAAACTATTTTGTGAACTGGAATGCTATGTCATCACTTATGGCAACCGAGGATCGGTCTCAAGAGAAATACATGGGAGACTCTTTTCGATATTACCATGATTCAGTGGTTTTGATGAATAAAGGCTTAGAGATGGAGCTGGTACGCATCCTAAAAATCTACACAGCTCTCGACTTTTCTGAAAACAAATTAGAAGGAGAGATTCCAAGATCCATCGGTCTTTTGAAAGAGCTTCATGTTCTTAACTTGTCAAGCAATGCTTTCACCGGCCACATCCCATCATCTATGGGGAATCTTAGAGAGCTCGAGTCACTGGACGTTTCTCAAAACAAGCTTTCAGGAGAAATTCCACAAGAATTAGGGAACCTATCGTACCTTGCCTACATGAACTTCTCTCACAACCAGCTTGGAGGTCTAGTACCAGGGGGAACTCAGTTTCGTCGACAAAACTGCTCTTCTTTCAAGGACAACCCTGGACTTTATGGCTCTTCACTTGAAGAAGTTTGTTTAGATATTCATGCACCAGCACCGCAACAACATGAACCGCCAGAGTTAGAGGAAGAAGACAGAGAGGTGTTCAGTTGGATAGCAGCTGCAATAGGATTCGGACCTGGTATTGCCTTTGGATTGACGATTAGATACATACTGGTTTTCTACAAACCAGATTGGTTCATGCATACCTTTGGCCACTTACAACCCTCTGCACATGAAAAAAGATTGAGGAGAAAGCAATAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MKDSWNSTSIIPFTFSSLIFFLFTFDFQDVFGVPTKHLCRLEQRDALLELKKEFKIKKPCFDGLHPTTESWANNSDCCYWDGITCNDKSGEVLELDLSRSCLQSRFHSNSSLFTVLNLRFLTTLDLSYNYFSGQIPSCIENFSHLTTLDLSKNYFSGGIPSSIGNLSQLTFLDLSGNEFVGEMPFFGNMNQLTNLYVDSNDLTGIFPLSLLNLKHLSDLSLSRNQFTGTLPSNMSSLSNLEYFEAWGNAFTGTLPSSLFTIASLTSINLRNNQLNGTLEFGNISSPSTLTVLDISNNNFIGPIPKSISKFINLQDLDLSHLNTQGPVDFSIFTNLKSLQLLNLSHLNTTTTIDLNALFSSHLNSIYSMDLSGNHVSATTKISVADHHPTQLISQLYLSGCGITEFPELLRSQHKMTNLDISNNKIKGQVPGWLWTLPKLIFVDLSNNIFTGFERSTEHGLSLITKPSMQYLVGSNNNFTGKIPSFICALRSLITLDLSDNNLNGSIPPCMGNLKSTLSFLNLRQNRLGGGLPRSIFKSLRSLDVGHNQLVGKLPRSFIRLSALEVLNVENNRINDTFPFWLSSLKKLQVLVLRSNAFHGPIHHASFHTLRIINLSHNQFSGTLPANYFVNWNAMSSLMATEDRSQEKYMGDSFRYYHDSVVLMNKGLEMELVRILKIYTALDFSENKLEGEIPRSIGLLKELHVLNLSSNAFTGHIPSSMGNLRELESLDVSQNKLSGEIPQELGNLSYLAYMNFSHNQLGGLVPGGTQFRRQNCSSFKDNPGLYGSSLEEVCLDIHAPAPQQHEPPELEEEDREVFSWIAAAIGFGPGIAFGLTIRYILVFYKPDWFMHTFGHLQPSAHEKRLRRKQ


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-844 PTHR24420,FAMILY NOT NAMED

MKDSWNSTSIIPFTFSSLIFFLFTFDFQDVFGVPTKHLCRLEQRDALLELKKEFKIKKPCFDGLHPTTESWANNSDCCYWDGITCNDKSGEVLELDLSRSCLQSRFHSNSSLFTVLNLRFLTTLDLSYNYFSGQIPSCIENFSHLTTLDLSKNYFSGGIPSSIGNLSQLTFLDLSGNEFVGEMPFFGNMNQLTNLYVDSNDLTGIFPLSLLNLKHLSDLSLSRNQFTGTLPSNMSSLSNLEYFEAWGNAFTGTLPSSLFTIASLTSINLRNNQLNGTLEFGNISSPSTLTVLDISNNNFIGPIPKSISKFINLQDLDLSHLNTQGPVDFSIFTNLKSLQLLNLSHLNTTTTIDLNALFSSHLNSIYSMDLSGNHVSATTKISVADHHPTQLISQLYLSGCGITEFPELLRSQHKMTNLDISNNKIKGQVPGWLWTLPKLIFVDLSNNIFTGFERSTEHGLSLITKPSMQYLVGSNNNFTGKIPSFICALRSLITLDLSDNNLNGSIPPCMGNLKSTLSFLNLRQNRLGGGLPRSIFKSLRSLDVGHNQLVGKLPRSFIRLSALEVLNVENNRINDTFPFWLSSLKKLQVLVLRSNAFHGPIHHASFHTLRIINLSHNQFSGTLPANYFVNWNAMSSLMATEDRSQEKYMGDSFRYYHDSVVLMNKGLEMELVRILKIYTALDFSENKLEGEIPRSIGLLKELHVLNLSSNAFTGHIPSSMGNLRELESLDVSQNKLSGEIPQELGNLSYLAYMNFSHNQLGGLVPGGTQFRRQNCSSFKDNPGLYGSSLEEVCLDIHAPAPQQHEPPELEEEDREVFSWIAAAIGFGPGIAFGLTIRYILVFYK

HMMPanther: PTHR24420:SF910
1-844 PTHR24420:SF910

MKDSWNSTSIIPFTFSSLIFFLFTFDFQDVFGVPTKHLCRLEQRDALLELKKEFKIKKPCFDGLHPTTESWANNSDCCYWDGITCNDKSGEVLELDLSRSCLQSRFHSNSSLFTVLNLRFLTTLDLSYNYFSGQIPSCIENFSHLTTLDLSKNYFSGGIPSSIGNLSQLTFLDLSGNEFVGEMPFFGNMNQLTNLYVDSNDLTGIFPLSLLNLKHLSDLSLSRNQFTGTLPSNMSSLSNLEYFEAWGNAFTGTLPSSLFTIASLTSINLRNNQLNGTLEFGNISSPSTLTVLDISNNNFIGPIPKSISKFINLQDLDLSHLNTQGPVDFSIFTNLKSLQLLNLSHLNTTTTIDLNALFSSHLNSIYSMDLSGNHVSATTKISVADHHPTQLISQLYLSGCGITEFPELLRSQHKMTNLDISNNKIKGQVPGWLWTLPKLIFVDLSNNIFTGFERSTEHGLSLITKPSMQYLVGSNNNFTGKIPSFICALRSLITLDLSDNNLNGSIPPCMGNLKSTLSFLNLRQNRLGGGLPRSIFKSLRSLDVGHNQLVGKLPRSFIRLSALEVLNVENNRINDTFPFWLSSLKKLQVLVLRSNAFHGPIHHASFHTLRIINLSHNQFSGTLPANYFVNWNAMSSLMATEDRSQEKYMGDSFRYYHDSVVLMNKGLEMELVRILKIYTALDFSENKLEGEIPRSIGLLKELHVLNLSSNAFTGHIPSSMGNLRELESLDVSQNKLSGEIPQELGNLSYLAYMNFSHNQLGGLVPGGTQFRRQNCSSFKDNPGLYGSSLEEVCLDIHAPAPQQHEPPELEEEDREVFSWIAAAIGFGPGIAFGLTIRYILVFYK

HMMPfam: PF08263
IPR013210
42-86 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EQRDALLELKKEFKIKKPCFDGLHPTTESWANNSDCCYWDGITCN

Gene3D: G3DSA:3.80.10.10
43-368 G3DSA:3.80.10.10

QRDALLELKKEFKIKKPCFDGLHPTTESWANNSDCCYWDGITCNDKSGEVLELDLSRSCLQSRFHSNSSLFTVLNLRFLTTLDLSYNYFSGQIPSCIENFSHLTTLDLSKNYFSGGIPSSIGNLSQLTFLDLSGNEFVGEMPFFGNMNQLTNLYVDSNDLTGIFPLSLLNLKHLSDLSLSRNQFTGTLPSNMSSLSNLEYFEAWGNAFTGTLPSSLFTIASLTSINLRNNQLNGTLEFGNISSPSTLTVLDISNNNFIGPIPKSISKFINLQDLDLSHLNTQGPVDFSIFTNLKSLQLLNLSHLNTTTTIDLNALFSSHLNSIYSM

HMMPfam: PF13855
121-178 LRR_8,Leucine rich repeat

LTTLDLSYNYFSGQIPSCIENFSHLTTLDLSKNYFSGGIPSSIGNLSQLTFLDLSGNE

superfamily: SSF52047
123-450 SSF52047,LRR

TLDLSYNYFSGQIPSCIENFSHLTTLDLSKNYFSGGIPSSIGNLSQLTFLDLSGNEFVGEMPFFGNMNQLTNLYVDSNDLTGIFPLSLLNLKHLSDLSLSRNQFTGTLPSNMSSLSNLEYFEAWGNAFTGTLPSSLFTIASLTSINLRNNQLNGTLEFGNISSPSTLTVLDISNNNFIGPIPKSISKFINLQDLDLSHLNTQGPVDFSIFTNLKSLQLLNLSHLNTTTTIDLNALFSSHLNSIYSMDLSGNHVSATTKISVADHHPTQLISQLYLSGCGITEFPELLRSQHKMTNLDISNNKIKGQVPGWLWTLPKLIFVDLSNNIFT

HMMPfam: PF13516
213-235 LRR_6,Leucine Rich repeat

LKHLSDLSLSRNQFTGTLPSNMS

HMMPfam: PF00560
IPR001611
289-309 LRR_1
Leucine-rich repeat

LTVLDISNNNFIGPIPKSISK

Gene3D: G3DSA:3.80.10.10
369-525 G3DSA:3.80.10.10

DLSGNHVSATTKISVADHHPTQLISQLYLSGCGITEFPELLRSQHKMTNLDISNNKIKGQVPGWLWTLPKLIFVDLSNNIFTGFERSTEHGLSLITKPSMQYLVGSNNNFTGKIPSFICALRSLITLDLSDNNLNGSIPPCMGNLKSTLSFLNLRQN

superfamily: SSF52058
392-782 SSF52058,LRR

ISQLYLSGCGITEFPELLRSQHKMTNLDISNNKIKGQVPGWLWTLPKLIFVDLSNNIFTGFERSTEHGLSLITKPSMQYLVGSNNNFTGKIPSFICALRSLITLDLSDNNLNGSIPPCMGNLKSTLSFLNLRQNRLGGGLPRSIFKSLRSLDVGHNQLVGKLPRSFIRLSALEVLNVENNRINDTFPFWLSSLKKLQVLVLRSNAFHGPIHHASFHTLRIINLSHNQFSGTLPANYFVNWNAMSSLMATEDRSQEKYMGDSFRYYHDSVVLMNKGLEMELVRILKIYTALDFSENKLEGEIPRSIGLLKELHVLNLSSNAFTGHIPSSMGNLRELESLDVSQNKLSGEIPQELGNLSYLAYMNFSHNQLGGLVPGGTQFRRQNCSSFKDNP

HMMPfam: PF13855
393-447 LRR_8,Leucine rich repeat

SQLYLSGCGITEFPELLRSQHKMTNLDISNNKIKGQVPGWLWTLPKLIFVDLSNN

HMMPfam: PF00560
IPR001611
491-512 LRR_1
Leucine-rich repeat

SLITLDLSDNNLNGSIPPCMGN

FPrintScan: PR00019
492-505 LEURICHRPT,Leucine-rich repeat signature

LITLDLSDNNLNGS

Gene3D: G3DSA:3.80.10.10
526-636 G3DSA:3.80.10.10

RLGGGLPRSIFKSLRSLDVGHNQLVGKLPRSFIRLSALEVLNVENNRINDTFPFWLSSLKKLQVLVLRSNAFHGPIHHASFHTLRIINLSHNQFSGTLPANYFVNWNAMSS

HMMPfam: PF13855
538-596 LRR_8,Leucine rich repeat

SLRSLDVGHNQLVGKLPRSFIRLSALEVLNVENNRINDTFPFWLSSLKKLQVLVLRSNA

HMMPfam: PF00560
IPR001611
609-630 LRR_1
Leucine-rich repeat

LRIINLSHNQFSGTLPANYFVN

Gene3D: G3DSA:3.80.10.10
681-785 G3DSA:3.80.10.10

LDFSENKLEGEIPRSIGLLKELHVLNLSSNAFTGHIPSSMGNLRELESLDVSQNKLSGEIPQELGNLSYLAYMNFSHNQLGGLVPGGTQFRRQNCSSFKDNPGLY

HMMPfam: PF00560
IPR001611
702-723 LRR_1
Leucine-rich repeat

LHVLNLSSNAFTGHIPSSMGNL

FPrintScan: PR00019
723-736 LEURICHRPT,Leucine-rich repeat signature

LRELESLDVSQNKL

HMMPfam: PF13516
726-746 LRR_6,Leucine Rich repeat

LESLDVSQNKLSGEIPQELGN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox