PRGDB00047532 (F18C1.20)

From PRG Wiki
Jump to: navigation, search
F18C1.20
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12408732 (AC011620)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome III BAC F18C1 genomic sequence, complete sequence.

DNA Sequence

ATGAGTCTCATTCCTATTACTTTTTATTTTCTCTTCTTGTTCTTTTCTAATTTTCGAGGTGTTTTTGCTGTTCCTAATATACACTTATGTCATTTCGAACAAAGAGATGCACTTCTCGAGTTCAAGAACGAGTTTAAGATTAAGAAGCCTTGTTTTGGTTGTCCAAGTCCTCTGAAGACAAAGTCATGGGAGAATGGCAGCGACTGTTGTCATTGGGATGGTATTACTTGCGATGCTAAGACCGGGGAAGTAATCGAGATAGACCTTATGTGCAGCTGCCTCCATGGCTGGTTTCATTCCAACAGTAATCTTTCTATGCTTCAAAATTTCCATTTTCTAACCACTCTAGACCTTTCATATAATCATTTGAGTGGTCAAATCTCATCTTCTATTGGAAACCTTTCTCATCTCACCACTCTCGACCTTTCTGGAAATAACTTCAGTGGTTGGATTCCTTCTTCCCTTGGAAACCTTTTTCACCTCACCTCTCTCCACCTCTATGATAACAATTTTGGTGGTGAAATCCCATCTTCACTTGGAAATCTGTCGTATCTCACCTTTCTCGACCTATCTACTAACAATTTTGTTGGTGAAATCCCTTCTTCTTTTGGCAGTTTGAACCAATTGTCTATTTTACGTCTTGATAATAATAAGCTTAGTGGTAACCTCCCACTTGAAGTAATCAATCTTACAAAGTTGTCAGAGATATCACTCTCTCACAATCAGTTCACAGGCACGCTTCCTCCTAACATCACTTCACTCTCCATCTTGGAGTCCTTTTCGGCAAGTGGAAACAATTTCGTTGGAACTATCCCTTCCTCTCTCTTCACCATTCCTTCTATAACTCTTATTTTTTTGGACAATAACCAACTCAGCGGCACTCTTGAGTTTGGGAATATATCTTCACCGTCTAATTTACTAGTGTTACAACTTGGCGGTAACAACTTGAGAGGTCCAATCCCTACATCTATTTCCAGATTAGTCAACCTTAGGACACTTGACCTTTCCCATTTCAACATCCAAGGCCAAGTTGACTTTAATATCTTCTCGCATCTCAAGTTGCTAGGAAACCTTTACCTATCCCATTCCAACACCACCACTACAATTGACTTGAATGCAGTCTTATCATGTTTCAAGATGCTCATTTCATTGGATCTCTCAGGCAACCATGTTTTAGTCACAAACAAAAGTTCAGTTTCTGACCCTCCTTTGGGATTGATAGGCTCTTTGAACTTATCAGGATGCGGTATCACCGAGTTTCCAGATATCCTAAGAACGCAACGCCAAATGAGGACGCTAGACATTTCCAACAACAAAATCAAAGGCCAAGTGCCTAGCTGGTTACTATTACAGTTGGAGTACATGCATATCTCCAACAACAATTTCATCGGTTTCGAAAGATCAACGAAACTTGAAAAAACCGTAGTCCCAAAACCATCTATGAAGCACTTTTTTGGCTCCAATAACAATTTCAGTGGAAAGATTCCATCTTTCATATGCTCGTTGCGCTCTCTAATCATTCTCGATTTATCTAACAACAACTTCAGTGGTGCAATCCCTCCTTGTGTGGGAAAATTCAAGAGTACTCTTTCAGATCTTAACCTACGTCGGAATCGTCTTAGTGGAAGTCTTCCAAAGACTATAATAAAAAGTTTAAGGTCTCTTGATGTGAGTCATAACGAACTGGAGGGAAAGCTTCCAAGATCTTTGATCCACTTCTCTACTCTTGAAGTTTTGAATGTAGAAAGCAACAGAATCAACGACACGTTTCCGTTCTGGTTGAGTTCTCTAAAAAAGCTGCAAGTTCTTGTCTTACGCTCCAACGCATTTCACGGACGGATACACAAGACTCGGTTTCCTAAGTTGCGAATCATCGACATATCCCGTAATCACTTCAATGGGACATTGCCATCAGATTGCTTTGTGGAGTGGACTGGGATGCACTCACTTGAAAAAAATGAAGATCGGTTTAACGAAAAGTACATGGGATCAGGCTATTACCATGATTCAATGGTTCTGATGAATAAAGGCTTAGAGATGGAGCTGGTACGTATCCTAAAAATCTATACAGCTCTCGACTTCTCTGGAAACAAATTTGAAGGAGAGATTCCAAGATCCATCGGTCTATTGAAAGAACTTCATATCCTCAACTTGTCAAGCAATGGTTTCACCGGCCACATCCCATCATCTATGGGGAACCTGAGAGAGCTCGAGTCACTGGATGTTTCCCGAAACAAGCTTTCAGGAGAAATTCCACAAGAACTAGGGAACCTCTCGTACCTTGCGTACATGAACTTTTCTCATAACCAGCTTGTCGGTCAAGTACCAGGAGGCACCCAGTTTCGAACGCAATCCGCTTCGTCTTTTGAAGAAAACCTTGGACTTTGTGGTCGTCCTCTCGAAGAATGTAGAGTTGTCCATGAGCCGACGCCTTCAGGGGAATCAGAAACATTGGAATCAGAACAAGTCTTGAGTTGGATTGCAGCTGCCATAGGGTTCACACCTGGTATCGTGCTTGGATTGACCATTGGGCACATCGTGCTTTCCTCCAAACCGCGTTGGTTCTTCAAGGTGTTGTACATCAACAACAGTCGTAGACGCAGACGAACTCGTTCTGAGGTACCTTTTCCCTTAACGTTTTGTTCTCTATAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MSLIPITFYFLFLFFSNFRGVFAVPNIHLCHFEQRDALLEFKNEFKIKKPCFGCPSPLKTKSWENGSDCCHWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLTTLDLSYNHLSGQISSSIGNLSHLTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSSLGNLSYLTFLDLSTNNFVGEIPSSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNITSLSILESFSASGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNISSPSNLLVLQLGGNNLRGPIPTSISRLVNLRTLDLSHFNIQGQVDFNIFSHLKLLGNLYLSHSNTTTTIDLNAVLSCFKMLISLDLSGNHVLVTNKSSVSDPPLGLIGSLNLSGCGITEFPDILRTQRQMRTLDISNNKIKGQVPSWLLLQLEYMHISNNNFIGFERSTKLEKTVVPKPSMKHFFGSNNNFSGKIPSFICSLRSLIILDLSNNNFSGAIPPCVGKFKSTLSDLNLRRNRLSGSLPKTIIKSLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSNAFHGRIHKTRFPKLRIIDISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFNEKYMGSGYYHDSMVLMNKGLEMELVRILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGTQFRTQSASSFEENLGLCGRPLEECRVVHEPTPSGESETLESEQVLSWIAAAIGFTPGIVLGLTIGHIVLSSKPRWFFKVLYINNSRRRRRTRSEVPFPLTFCSL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF910
2-848 PTHR24420:SF910

SLIPITFYFLFLFFSNFRGVFAVPNIHLCHFEQRDALLEFKNEFKIKKPCFGCPSPLKTKSWENGSDCCHWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLTTLDLSYNHLSGQISSSIGNLSHLTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSSLGNLSYLTFLDLSTNNFVGEIPSSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNITSLSILESFSASGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNISSPSNLLVLQLGGNNLRGPIPTSISRLVNLRTLDLSHFNIQGQVDFNIFSHLKLLGNLYLSHSNTTTTIDLNAVLSCFKMLISLDLSGNHVLVTNKSSVSDPPLGLIGSLNLSGCGITEFPDILRTQRQMRTLDISNNKIKGQVPSWLLLQLEYMHISNNNFIGFERSTKLEKTVVPKPSMKHFFGSNNNFSGKIPSFICSLRSLIILDLSNNNFSGAIPPCVGKFKSTLSDLNLRRNRLSGSLPKTIIKSLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSNAFHGRIHKTRFPKLRIIDISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFNEKYMGSGYYHDSMVLMNKGLEMELVRILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGTQFRTQSASSFEENLGLCGRPLEECRVVHEPTPSGESETLESEQVLSWIAAAIGFTPGIVLGLTIGHIVL

HMMPanther: PTHR24420
2-848 PTHR24420,FAMILY NOT NAMED

SLIPITFYFLFLFFSNFRGVFAVPNIHLCHFEQRDALLEFKNEFKIKKPCFGCPSPLKTKSWENGSDCCHWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLTTLDLSYNHLSGQISSSIGNLSHLTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSSLGNLSYLTFLDLSTNNFVGEIPSSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNITSLSILESFSASGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNISSPSNLLVLQLGGNNLRGPIPTSISRLVNLRTLDLSHFNIQGQVDFNIFSHLKLLGNLYLSHSNTTTTIDLNAVLSCFKMLISLDLSGNHVLVTNKSSVSDPPLGLIGSLNLSGCGITEFPDILRTQRQMRTLDISNNKIKGQVPSWLLLQLEYMHISNNNFIGFERSTKLEKTVVPKPSMKHFFGSNNNFSGKIPSFICSLRSLIILDLSNNNFSGAIPPCVGKFKSTLSDLNLRRNRLSGSLPKTIIKSLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSNAFHGRIHKTRFPKLRIIDISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFNEKYMGSGYYHDSMVLMNKGLEMELVRILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGTQFRTQSASSFEENLGLCGRPLEECRVVHEPTPSGESETLESEQVLSWIAAAIGFTPGIVLGLTIGHIVL

superfamily: SSF52058
28-342 SSF52058,LRR

HLCHFEQRDALLEFKNEFKIKKPCFGCPSPLKTKSWENGSDCCHWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLTTLDLSYNHLSGQISSSIGNLSHLTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSSLGNLSYLTFLDLSTNNFVGEIPSSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNITSLSILESFSASGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNISSPSNLLVLQLGGNNLRGPIPTSISRLVNLRTLDLSHFNIQG

Gene3D: G3DSA:3.80.10.10
33-283 G3DSA:3.80.10.10

EQRDALLEFKNEFKIKKPCFGCPSPLKTKSWENGSDCCHWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLTTLDLSYNHLSGQISSSIGNLSHLTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSSLGNLSYLTFLDLSTNNFVGEIPSSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNITSLSILESFSASGNNFVGTIPSSLFTIPSITL

HMMPfam: PF08263
IPR013210
33-78 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EQRDALLEFKNEFKIKKPCFGCPSPLKTKSWENGSDCCHWDGITCD

HMMPfam: PF12799
113-150 LRR_4,Leucine Rich repeats (2 copies)

LTTLDLSYNHLSGQISSSIGNLSHLTTLDLSGNNFSGW

FPrintScan: PR00019
113-126 LEURICHRPT,Leucine-rich repeat signature

LTTLDLSYNHLSGQ

HMMPfam: PF13516
160-181 LRR_6,Leucine Rich repeat

HLTSLHLYDNNFGGEIPSSLGN

HMMPfam: PF00560
IPR001611
185-206 LRR_1
Leucine-rich repeat

LTFLDLSTNNFVGEIPSSFGSL

HMMPfam: PF00560
IPR001611
232-254 LRR_1
Leucine-rich repeat

KLSEISLSHNQFTGTLPPNITSL

Gene3D: G3DSA:3.80.10.10
284-392 G3DSA:3.80.10.10

IFLDNNQLSGTLEFGNISSPSNLLVLQLGGNNLRGPIPTSISRLVNLRTLDLSHFNIQGQVDFNIFSHLKLLGNLYLSHSNTTTTIDLNAVLSCFKMLISLDLSGNHVL

superfamily: SSF52047
409-772 SSF52047,LRR

SLNLSGCGITEFPDILRTQRQMRTLDISNNKIKGQVPSWLLLQLEYMHISNNNFIGFERSTKLEKTVVPKPSMKHFFGSNNNFSGKIPSFICSLRSLIILDLSNNNFSGAIPPCVGKFKSTLSDLNLRRNRLSGSLPKTIIKSLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSNAFHGRIHKTRFPKLRIIDISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFNEKYMGSGYYHDSMVLMNKGLEMELVRILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLV

Gene3D: G3DSA:3.80.10.10
410-538 G3DSA:3.80.10.10

LNLSGCGITEFPDILRTQRQMRTLDISNNKIKGQVPSWLLLQLEYMHISNNNFIGFERSTKLEKTVVPKPSMKHFFGSNNNFSGKIPSFICSLRSLIILDLSNNNFSGAIPPCVGKFKSTLSDLNLRRN

HMMPfam: PF00560
IPR001611
504-521 LRR_1
Leucine-rich repeat

SLIILDLSNNNFSGAIPP

Gene3D: G3DSA:3.80.10.10
539-652 G3DSA:3.80.10.10

RLSGSLPKTIIKSLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSNAFHGRIHKTRFPKLRIIDISRNHFNGTLPSDCFVEWTGMHSLEK

HMMPfam: PF13855
551-609 LRR_8,Leucine rich repeat

SLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSNA

Gene3D: G3DSA:3.80.10.10
692-802 G3DSA:3.80.10.10

LDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGTQFRTQSASSFEENLGLCGRPLEE

HMMPfam: PF00560
IPR001611
713-734 LRR_1
Leucine-rich repeat

LHILNLSSNGFTGHIPSSMGNL

FPrintScan: PR00019
734-747 LEURICHRPT,Leucine-rich repeat signature

LRELESLDVSRNKL

HMMPfam: PF00560
IPR001611
737-758 LRR_1
Leucine-rich repeat

LESLDVSRNKLSGEIPQELGNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox