PRGDB00047548 (nucleotide binding site leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
nucleotide binding site leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 40644879 (AJ581781)
Gene Class N
Domain Type NBS, Others
Gene Species Pyrus communis

Comment?

Pyrus communis partial gene for putative nucleotide binding site leucine-rich repeat disease resistance protein, clone RGA14.

DNA Sequence

TGTGGTGCGAGTGCAAAGGCAATTCTTGAATCAATCACATCCCGACCCGTTAAAGTGGAGGAGTTTAGTAAAATGCAGCATGATTTGAGTGAGCAATTAAGAGGAAAAAAGTTTTTAATTGTTTTAGATGATATTTGGGACAAAGATGACTATGATCTATACGATCTCTGGACAAGACTTCAATCCCCTTTTGGCGTCGGAGTAGGAGGAAGTAAGATAATTGTGACAACCCGTGACAGGAATGTTGCAAAGATTACGGGAGCCGCTGGAGTTCATAATTTGGAGTGTATGGCAGATGATGATTGTATGGAAATATTTGAGCGACACGCGTTCGGGGAAATTAATAACAGAAAACCAGTAAATTATGAGGTAATTCGGACGAAAATTGTTGGAAAATGTTGTGGATTACCATTAGCTGCAAAAACTCTCGGTAGTTTTTCCCACGCCTCCCAT


Protein sequences

Name Description Sequence
nucleotide binding site leucine-rich repeat disease resistance protein nucleotide binding site leucine-rich repeat disease resistance protein [Pyrus communis].

CGASAKAILESITSRPVKVEEFSKMQHDLSEQLRGKKFLIVLDDIWDKDDYDLYDLWTRLQSPFGVGVGGSKIIVTTRDRNVAKITGAAGVHNLECMADDDCMEIFERHAFGEINNRKPVNYEVIRTKIVGKCCGLPLAAKTLGSFSHASH

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
9-145 NB-ARC,NBS
NB-ARC

LESITSRPVKVEEFSKMQHDLSEQLRGKKFLIVLDDIWDKDDYDLYDLWTRLQSPFGVGVGGSKIIVTTRDRNVAKITGAAGVHNLECMADDDCMEIFERHAFGEINNRKPVNYEVIRTKIVGKCCGLPLAAKTLGS

superfamily: SSF52540
24-145 SSF52540

KMQHDLSEQLRGKKFLIVLDDIWDKDDYDLYDLWTRLQSPFGVGVGGSKIIVTTRDRNVAKITGAAGVHNLECMADDDCMEIFERHAFGEINNRKPVNYEVIRTKIVGKCCGLPLAAKTLGS

FPrintScan: PR00364
IPR000767
32-46 DISEASERSIST
Disease resistance protein

QLRGKKFLIVLDDIW

FPrintScan: PR00364
IPR000767
133-147 DISEASERSIST
Disease resistance protein

CCGLPLAAKTLGSFS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox