PRGDB00047549 (nucleotide binding site leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
nucleotide binding site leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 40644877 (AJ581780)
Gene Class NL
Domain Type NBS, LRR
Gene Species Pyrus communis

Comment?

Pyrus communis partial gene for putative nucleotide binding site leucine-rich repeat disease resistance protein, clone RGA13.

DNA Sequence

ATGGGGGGAGTGGGGAAGACAACCCTAGCTCAACTCCTTTACAATAATGACAGGGTGAAAGAGCATTTCGATGTTCGAGCTTGGGCGTGTGTTTCCGAAGACTTTGATGCTGTTAGGGTCACTAAAACCCTTGTTCAGTCAATTGCTTCAAAACCCTGTGATACGTCAGATATGAGCTTGCTTCAAGTTGCTCTTAAGGAACAACTAACGGGGAAAAGGTTTCTACTTGTGTTGGATGACCTTTGGAATGACGATTATAATGATTGGAGTGTTCTACAAGCTCCTTTCACTTATGGGGCGAGGGGAAGTAAGGTCATTGTGACAACAAGGAACGAAAGTGTTGCATCCATCGTGCACACTGTTCCTATTCACTCTTTAAAACAATTGTCGCATGATGATTGTTGGTTGTTACTTGCAAAACATGGCGTTTAG


Protein sequences

Name Description Sequence
nucleotide binding site leucine-rich repeat disease resistance protein nucleotide binding site leucine-rich repeat disease resistance protein [Pyrus communis].

MGGVGKTTLAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVIVTTRNESVASIVHTVPIHSLKQLSHDDCWLLLAKHGV


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-141 SSF52540

MGGVGKTTLAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVIVTTRNESVASIVHTVPIHSLKQLSHDDCWLLLAKH

HMMPanther: PTHR23155
1-106 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MGGVGKTTLAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVI

HMMPanther: PTHR23155:SF236
1-106 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

MGGVGKTTLAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVI

HMMPfam: PF00931
IPR002182
1-141 NB-ARC,NBS
NB-ARC

MGGVGKTTLAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVIVTTRNESVASIVHTVPIHSLKQLSHDDCWLLLAKH

Gene3D: G3DSA:3.40.50.300
3-114 G3DSA:3.40.50.300

GVGKTTLAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVIVTTRNESV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox