PRGDB00047553 (nucleotide binding site leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
nucleotide binding site leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 40644863 (AJ581773)
Gene Class NL
Domain Type NBS, LRR
Gene Species Pyrus communis

Comment?

Pyrus communis partial gene for putative nucleotide binding site leucine-rich repeat disease resistance protein, clone RGA06.

DNA Sequence

ATGGGCGGTGTGGGAAAGACGACACTTGCTCAACTTGTATTCAACAACAAAGATGATGCCATGAAGGATTTTGAGCTCAAGGTCTGGGTATCTGTGTCCGATGACTTTGATGTGGCGCGAGTGACAAAGGCAATTCTTGAATCAATCACATTCCGA


Protein sequences

Name Description Sequence
nucleotide binding site leucine-rich repeat disease resistance protein nucleotide binding site leucine-rich repeat disease resistance protein [Pyrus communis].

MGGVGKTTLAQLVFNNKDDAMKDFELKVWVSVSDDFDVARVTKAILESITFR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF140
1-47 PTHR23155:SF140,OS03G0849500 PROTEIN

MGGVGKTTLAQLVFNNKDDAMKDFELKVWVSVSDDFDVARVTKAILE

HMMPanther: PTHR23155
1-47 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MGGVGKTTLAQLVFNNKDDAMKDFELKVWVSVSDDFDVARVTKAILE

HMMPfam: PF00931
IPR002182
1-49 NB-ARC,NBS
NB-ARC

MGGVGKTTLAQLVFNNKDDAMKDFELKVWVSVSDDFDVARVTKAILESI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox