PRGDB00047560 (disease resistance protein A13)

From PRG Wiki
Jump to: navigation, search
disease resistance protein A13
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6648974 (AF121436)
Gene Class NL
Domain Type NBS, LRR
Gene Species Capsicum annuum

Comment?

Capsicum annuum disease resistance protein A13 gene, partial cds.

DNA Sequence

AATGGGGGAGTTGGTAAAACAACAATAGCAAAAGCCATGTTTGATACTCTATCCTATCAATTTAAAGCTGCTTGTTTTCTTGCAGATGTTAAGGAAAATTCAAGAAAGAATGAACTGCACTCTTTACAAAATACCCTCCTCTCTGAACTGTTAAGAAAAAAAGATAATTACATCAACAATAAGTTAGACGGGAAGTGCCTGATTCCAAGCAGACTTTGTTCTATGAATGTGCTAATTGTGCTTCATAATGATCATTTGGAGTATTTAGCAGGTGATCTTTGTTGGTTTGGAATTGGTAGCAGAGTTGTTGTAACAACTAGAAATAGACATTTGATAGAGAAGGATGATGCAATATATGAAGTGCCTGCACTACCTGATCCTGAAGCTATGCAATTGTGCAATCAACATGCTTTAAAAAAAGAAATTTCAGATGAGTGTTTTAAGATGTTCTCGTTGGAGGTCGTAAATATTGCTAAAGGCCTTCCATTAGCCCTCAAAGTGTGGGGCTCTTTCTTACATAGGAGGGATATAACTGAGTGGAGAAATGCTATAGAGCAAATGAAATATAACTCTAATTCAGAAATTATTCAAAAGCTCAAAATAAGTTATGAT


Protein sequences

Name Description Sequence
disease resistance protein A13 disease resistance protein A13 [Capsicum annuum].

NGGVGKTTIAKAMFDTLSYQFKAACFLADVKENSRKNELHSLQNTLLSELLRKKDNYINNKLDGKCLIPSRLCSMNVLIVLHNDHLEYLAGDLCWFGIGSRVVVTTRNRHLIEKDDAIYEVPALPDPEAMQLCNQHALKKEISDECFKMFSLEVVNIAKGLPLALKVWGSFLHRRDITEWRNAIEQMKYNSNSEIIQKLKISYD


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
2-195 SSF52540

GGVGKTTIAKAMFDTLSYQFKAACFLADVKENSRKNELHSLQNTLLSELLRKKDNYINNKLDGKCLIPSRLCSMNVLIVLHNDHLEYLAGDLCWFGIGSRVVVTTRNRHLIEKDDAIYEVPALPDPEAMQLCNQHALKKEISDECFKMFSLEVVNIAKGLPLALKVWGSFLHRRDITEWRNAIEQMKYNSNSEI

HMMPanther: PTHR11017:SF20
2-204 PTHR11017:SF20,SUBFAMILY NOT NAMED

GGVGKTTIAKAMFDTLSYQFKAACFLADVKENSRKNELHSLQNTLLSELLRKKDNYINNKLDGKCLIPSRLCSMNVLIVLHNDHLEYLAGDLCWFGIGSRVVVTTRNRHLIEKDDAIYEVPALPDPEAMQLCNQHALKKEISDECFKMFSLEVVNIAKGLPLALKVWGSFLHRRDITEWRNAIEQMKYNSNSEIIQKLKISYD

HMMPfam: PF00931
IPR002182
2-204 NB-ARC,NBS
NB-ARC

GGVGKTTIAKAMFDTLSYQFKAACFLADVKENSRKNELHSLQNTLLSELLRKKDNYINNKLDGKCLIPSRLCSMNVLIVLHNDHLEYLAGDLCWFGIGSRVVVTTRNRHLIEKDDAIYEVPALPDPEAMQLCNQHALKKEISDECFKMFSLEVVNIAKGLPLALKVWGSFLHRRDITEWRNAIEQMKYNSNSEIIQKLKISYD

HMMPanther: PTHR11017
2-204 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTIAKAMFDTLSYQFKAACFLADVKENSRKNELHSLQNTLLSELLRKKDNYINNKLDGKCLIPSRLCSMNVLIVLHNDHLEYLAGDLCWFGIGSRVVVTTRNRHLIEKDDAIYEVPALPDPEAMQLCNQHALKKEISDECFKMFSLEVVNIAKGLPLALKVWGSFLHRRDITEWRNAIEQMKYNSNSEIIQKLKISYD

Gene3D: G3DSA:3.40.50.300
3-77 G3DSA:3.40.50.300

GVGKTTIAKAMFDTLSYQFKAACFLADVKENSRKNELHSLQNTLLSELLRKKDNYINNKLDGKCLIPSRLCSMNV


List of References

S Pflieger, V Lefebvre, C Caranta, A Blattes, B Goffinet, A Palloix
Disease resistance gene analogs as candidates for QTLs involved in pepper-pathogen interactions.
Genome: 1999, 42(6);1100-10
PubMed:10659776 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox