PRGDB00047562 (Big1)

From PRG Wiki
Jump to: navigation, search
Big1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 5739322 (AF166121)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Hordeum vulgare subsp. vulgare

Comment?

Hordeum vulgare Cf2/Cf5 disease resistance protein homolog (Big1) gene, complete cds.

DNA Sequence

ATGGATAGCTCGCCTTCCGCCAAGTCCGTGTTGCTCCTCATGGCAGCAGCGGCAGCCTGGATCAGCTTCTTCCTTGTCGCCGACGCGTCTGCCGGCGCCGTGGCCTGCATACGGCGCGAGCGGGACGCGCTGCTGGCCTTGAAGCAAGGCATCAACGACACCGATGATGAACTCAGGTCGTGGCAGCGAGGGAGCCAAGATTGCTGCCGATGGGCAGGCATCACCTGCAGCAACATGACCGGCCGTGTCATCGGGCTTGACCTTAGCCGGAGGTTTTCTTTGGTCGGCCAGATAAGTCCTTCCTTGCTTTCTCTAGAGCATCTCCAGTACCTCAATCTCAAGTCCACATCCCTGTGTGGGCATGGTGGCCGTATTCCAGAGTTCTTGGGTTCTTTAAACAACTTGAGACATCTGGATCTCTCCTACATGTCTTTCTCCGGTGTGTTGCCTCCTCAGCTAGGCAACCTTTCAAAGCTGGAATATCTCGACCTCTCCAACATGGAGATGGACGTGATAGACATATCATGGTTATCCCGTTTACCTAGGTTGATGTATCTTGACATTAGTTATACGAATCTCAGCTCAATAGCTGCTTGGCCTCCTGTGGTGAACATGATTCCTTCTTTGAAGGACCTCCGCCTTTCTTACTGCTCACTTTCCAGTACAAACCAATCCCTCACACACCTAAACCTCACAAATCTTCAGCACCTTGATCTCTCGCGTAACTACTTTGCTCATCCAATTGCTTCCAGTTGGTTTTGGAATGTAACAAGCATTGAGTACCTCGACCTTTCTGATACCTCCCTGCATGGTCCATTTCCTAATGCACTAGGAAAAATGACGTTTCTCCGCCAGCTATCCTTTTTTGGAATTGGTAACACAGCCACAATGACAGTAGATTTGAAAAATCTATGTGATTTGGAAATTATATGGCTTGATGGGAGTCTCTCCTCTGGAAATGTAACAGAGTTTTTGAAGAAGTTGCCACGCCGCTGCCCGTCAAACAGATTGCAAGAATTGAAGCTTAGCAGCAACAATATGGTTGGAATGCTGCCAAACAGAATGGACTACTTAACAAACTTATCTAGTCTCGACCTGTCCTACAATAACATAACTGGAGCTATACCGCCATGGTTGGAAAATTGTACTAGTTTGTCCTATCTTTCTCTTTCCAGCAATAGTCTTACTGGACCTATACCAGTAGGGATAGGGAGGTGCACTCTATTAGACATCCTCGACCTTTCTTACAACAATATTACTGGAGCTATACCGCTAGGCATAGGGAACTTCACTACATTGAGGTACCTTGTTCTTTCTCACAACCTTTTGAGTGGACATGTGCCTTCTAAGATTGGCATGCTCGGTGATTTGATTGACCTTGACCTTAGCAACAATAACCTGGATGGCCTGTTCACGAGGGAACACATGGTTTCCCTAAAGAACTTAAGGCACATGGATTTGTCGCACAATTCTTTCTCAGGTCCTCTCCCGATAGAAACCAGAGCTCAATTTTTAAAAGAATTGACTTTGTCCTCCAATTACTTCAGTGGTCATATTCCTGAATCTATATGTCAGTTGCGGAACCTACTTGTCTTGGATCTATCAGACAACTTTTTAGAGGGAGAACTTCCTCACTGTTCTCATAAGCCTAACTTGGTTTTCCTCCTCTTAAGTAACAACGGCTTTTCTGGCAAGTTCCCATCATCACTTCGAAACTACTCTAGTTTGGCTTTCATGGATCTTTCATGGAACAATTTGTATGGGACATTGCCGTTCTGGATTGAAGAATTGGTAAATTTGCGCTTTCTGCAACTAAGCCACAACTTGTTGTATGGAGATATTCCGGTGACTATCACAAATCTTCAGCACCTTCATCAATTGAGTTTAGCGGGGAATAATATATCTGGAGCTATACCTGAGTCTTTGTCAAATTTAACATCAATGGCCCAAAAAGATCCACAGAACTCCGAGGACTACATGTCTGCATGGTACAACAACAATGTAGGTACATTTAGACAAGTTTGGCATGTTGTGATGAAACGCCAAGAACTTAAGTATGGTGCTGGAATTTTTGATGTGGTTGGTATTGACCTATCACTCAACCACTTAATTGGTGAGATTCCAGAAATGATAACTTCTCTTGGTGGATTACTGAATTTAAACTTATCATGGAACCACTTGAGTGGGAAAATTCCCGGGAAGATTGGGGCTATGAAATCAGTCGAATCACTCGACCTCTCAAGGAACAACCTTTATGGTGAAATCCCAGCAAGCTTGTCTGAATTGACGTTTTTAAGCTCCTTGGACTTGTCATATAACAATCTTACAGGAATAATTCCCCGAGGAAGTCAACTTGACACTATCTACATTGAGAACCCAGCAATATACACTGGTAACATTGGTTTGTGTGGCCCTCCACTTGAAAGGAATTGCTCAGGAAACAACTCACTGGAGCATGTGAATCAACCGAGAAGGGACAATGTTTATGAGGCAAAGATGTTCTTTTACTTTGGACTTGGATCTGGGTATGTGGCCGGCCTTTGGGTTGTGTTTTGTGCTATGCTATTCAGGAAGGCATGGAGAGTTGCCTATTTCCGCCTCTTTGACAAGTTGTATGACAAAGCATATGTATTTGCGGTTCTTACTTGGGGCAGGATAAATGGCAAGGCAAGTACAAGTTGA


Protein sequences

Name Description Sequence
Cf2/Cf5 disease resistance protein homolog Cf2/Cf5 disease resistance protein homolog [Hordeum vulgare].

MDSSPSAKSVLLLMAAAAAWISFFLVADASAGAVACIRRERDALLALKQGINDTDDELRSWQRGSQDCCRWAGITCSNMTGRVIGLDLSRRFSLVGQISPSLLSLEHLQYLNLKSTSLCGHGGRIPEFLGSLNNLRHLDLSYMSFSGVLPPQLGNLSKLEYLDLSNMEMDVIDISWLSRLPRLMYLDISYTNLSSIAAWPPVVNMIPSLKDLRLSYCSLSSTNQSLTHLNLTNLQHLDLSRNYFAHPIASSWFWNVTSIEYLDLSDTSLHGPFPNALGKMTFLRQLSFFGIGNTATMTVDLKNLCDLEIIWLDGSLSSGNVTEFLKKLPRRCPSNRLQELKLSSNNMVGMLPNRMDYLTNLSSLDLSYNNITGAIPPWLENCTSLSYLSLSSNSLTGPIPVGIGRCTLLDILDLSYNNITGAIPLGIGNFTTLRYLVLSHNLLSGHVPSKIGMLGDLIDLDLSNNNLDGLFTREHMVSLKNLRHMDLSHNSFSGPLPIETRAQFLKELTLSSNYFSGHIPESICQLRNLLVLDLSDNFLEGELPHCSHKPNLVFLLLSNNGFSGKFPSSLRNYSSLAFMDLSWNNLYGTLPFWIEELVNLRFLQLSHNLLYGDIPVTITNLQHLHQLSLAGNNISGAIPESLSNLTSMAQKDPQNSEDYMSAWYNNNVGTFRQVWHVVMKRQELKYGAGIFDVVGIDLSLNHLIGEIPEMITSLGGLLNLNLSWNHLSGKIPGKIGAMKSVESLDLSRNNLYGEIPASLSELTFLSSLDLSYNNLTGIIPRGSQLDTIYIENPAIYTGNIGLCGPPLERNCSGNNSLEHVNQPRRDNVYEAKMFFYFGLGSGYVAGLWVVFCAMLFRKAWRVAYFRLFDKLYDKAYVFAVLTWGRINGKASTS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393
12-888 PTHR26393,FAMILY NOT NAMED

LLMAAAAAWISFFLVADASAGAVACIRRERDALLALKQGINDTDDELRSWQRGSQDCCRWAGITCSNMTGRVIGLDLSRRFSLVGQISPSLLSLEHLQYLNLKSTSLCGHGGRIPEFLGSLNNLRHLDLSYMSFSGVLPPQLGNLSKLEYLDLSNMEMDVIDISWLSRLPRLMYLDISYTNLSSIAAWPPVVNMIPSLKDLRLSYCSLSSTNQSLTHLNLTNLQHLDLSRNYFAHPIASSWFWNVTSIEYLDLSDTSLHGPFPNALGKMTFLRQLSFFGIGNTATMTVDLKNLCDLEIIWLDGSLSSGNVTEFLKKLPRRCPSNRLQELKLSSNNMVGMLPNRMDYLTNLSSLDLSYNNITGAIPPWLENCTSLSYLSLSSNSLTGPIPVGIGRCTLLDILDLSYNNITGAIPLGIGNFTTLRYLVLSHNLLSGHVPSKIGMLGDLIDLDLSNNNLDGLFTREHMVSLKNLRHMDLSHNSFSGPLPIETRAQFLKELTLSSNYFSGHIPESICQLRNLLVLDLSDNFLEGELPHCSHKPNLVFLLLSNNGFSGKFPSSLRNYSSLAFMDLSWNNLYGTLPFWIEELVNLRFLQLSHNLLYGDIPVTITNLQHLHQLSLAGNNISGAIPESLSNLTSMAQKDPQNSEDYMSAWYNNNVGTFRQVWHVVMKRQELKYGAGIFDVVGIDLSLNHLIGEIPEMITSLGGLLNLNLSWNHLSGKIPGKIGAMKSVESLDLSRNNLYGEIPASLSELTFLSSLDLSYNNLTGIIPRGSQLDTIYIENPAIYTGNIGLCGPPLERNCSGNNSLEHVNQPRRDNVYEAKMFFYFGLGSGYVAGLWVVFCAMLFRKAWRVAYFRLFDKLYDKAYVFAVLTWGRING

HMMPanther: PTHR26393:SF516
12-888 PTHR26393:SF516

LLMAAAAAWISFFLVADASAGAVACIRRERDALLALKQGINDTDDELRSWQRGSQDCCRWAGITCSNMTGRVIGLDLSRRFSLVGQISPSLLSLEHLQYLNLKSTSLCGHGGRIPEFLGSLNNLRHLDLSYMSFSGVLPPQLGNLSKLEYLDLSNMEMDVIDISWLSRLPRLMYLDISYTNLSSIAAWPPVVNMIPSLKDLRLSYCSLSSTNQSLTHLNLTNLQHLDLSRNYFAHPIASSWFWNVTSIEYLDLSDTSLHGPFPNALGKMTFLRQLSFFGIGNTATMTVDLKNLCDLEIIWLDGSLSSGNVTEFLKKLPRRCPSNRLQELKLSSNNMVGMLPNRMDYLTNLSSLDLSYNNITGAIPPWLENCTSLSYLSLSSNSLTGPIPVGIGRCTLLDILDLSYNNITGAIPLGIGNFTTLRYLVLSHNLLSGHVPSKIGMLGDLIDLDLSNNNLDGLFTREHMVSLKNLRHMDLSHNSFSGPLPIETRAQFLKELTLSSNYFSGHIPESICQLRNLLVLDLSDNFLEGELPHCSHKPNLVFLLLSNNGFSGKFPSSLRNYSSLAFMDLSWNNLYGTLPFWIEELVNLRFLQLSHNLLYGDIPVTITNLQHLHQLSLAGNNISGAIPESLSNLTSMAQKDPQNSEDYMSAWYNNNVGTFRQVWHVVMKRQELKYGAGIFDVVGIDLSLNHLIGEIPEMITSLGGLLNLNLSWNHLSGKIPGKIGAMKSVESLDLSRNNLYGEIPASLSELTFLSSLDLSYNNLTGIIPRGSQLDTIYIENPAIYTGNIGLCGPPLERNCSGNNSLEHVNQPRRDNVYEAKMFFYFGLGSGYVAGLWVVFCAMLFRKAWRVAYFRLFDKLYDKAYVFAVLTWGRING

Gene3D: G3DSA:3.80.10.10
36-308 G3DSA:3.80.10.10

CIRRERDALLALKQGINDTDDELRSWQRGSQDCCRWAGITCSNMTGRVIGLDLSRRFSLVGQISPSLLSLEHLQYLNLKSTSLCGHGGRIPEFLGSLNNLRHLDLSYMSFSGVLPPQLGNLSKLEYLDLSNMEMDVIDISWLSRLPRLMYLDISYTNLSSIAAWPPVVNMIPSLKDLRLSYCSLSSTNQSLTHLNLTNLQHLDLSRNYFAHPIASSWFWNVTSIEYLDLSDTSLHGPFPNALGKMTFLRQLSFFGIGNTATMTVDLKNLCDLE

HMMPfam: PF08263
IPR013210
40-77 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ERDALLALKQGINDTDDELRSWQRGSQDCCRWAGITCS

superfamily: SSF52047
85-420 SSF52047,LRR

GLDLSRRFSLVGQISPSLLSLEHLQYLNLKSTSLCGHGGRIPEFLGSLNNLRHLDLSYMSFSGVLPPQLGNLSKLEYLDLSNMEMDVIDISWLSRLPRLMYLDISYTNLSSIAAWPPVVNMIPSLKDLRLSYCSLSSTNQSLTHLNLTNLQHLDLSRNYFAHPIASSWFWNVTSIEYLDLSDTSLHGPFPNALGKMTFLRQLSFFGIGNTATMTVDLKNLCDLEIIWLDGSLSSGNVTEFLKKLPRRCPSNRLQELKLSSNNMVGMLPNRMDYLTNLSSLDLSYNNITGAIPPWLENCTSLSYLSLSSNSLTGPIPVGIGRCTLLDILDLSYNNIT

HMMPfam: PF00560
IPR001611
134-156 LRR_1
Leucine-rich repeat

NLRHLDLSYMSFSGVLPPQLGNL

HMMPfam: PF13855
157-197 LRR_8,Leucine rich repeat

SKLEYLDLSNMEMDVIDISWLSRLPRLMYLDISYTNLSSIA

ProfileScan: PS51450
IPR001611
158-178 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEYLDLSNMEMDVIDISWLS

ProfileScan: PS51450
IPR001611
182-203 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLMYLDISYTNLSSIAAWPPVV

HMMPfam: PF13855
207-269 LRR_8,Leucine rich repeat

PSLKDLRLSYCSLSSTNQSLTHLNLTNLQHLDLSRNYFAHPIASSWFWNVTSIEYLDLSDTSL

ProfileScan: PS51450
IPR001611
208-230 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKDLRLSYCSLSSTNQSLTHLN

ProfileScan: PS51450
IPR001611
233-255 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQHLDLSRNYFAHPIASSWFWN

Gene3D: G3DSA:3.80.10.10
309-497 G3DSA:3.80.10.10

IIWLDGSLSSGNVTEFLKKLPRRCPSNRLQELKLSSNNMVGMLPNRMDYLTNLSSLDLSYNNITGAIPPWLENCTSLSYLSLSSNSLTGPIPVGIGRCTLLDILDLSYNNITGAIPLGIGNFTTLRYLVLSHNLLSGHVPSKIGMLGDLIDLDLSNNNLDGLFTREHMVSLKNLRHMDLSHNSFSGPLP

HMMPfam: PF13855
336-395 LRR_8,Leucine rich repeat

RLQELKLSSNNMVGMLPNRMDYLTNLSSLDLSYNNITGAIPPWLENCTSLSYLSLSSNSL

ProfileScan: PS51450
IPR001611
360-383 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSSLDLSYNNITGAIPPWLENCT

ProfileScan: PS51450
IPR001611
384-406 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSYLSLSSNSLTGPIPVGIGRC

superfamily: SSF52058
400-792 SSF52058,LRR

PVGIGRCTLLDILDLSYNNITGAIPLGIGNFTTLRYLVLSHNLLSGHVPSKIGMLGDLIDLDLSNNNLDGLFTREHMVSLKNLRHMDLSHNSFSGPLPIETRAQFLKELTLSSNYFSGHIPESICQLRNLLVLDLSDNFLEGELPHCSHKPNLVFLLLSNNGFSGKFPSSLRNYSSLAFMDLSWNNLYGTLPFWIEELVNLRFLQLSHNLLYGDIPVTITNLQHLHQLSLAGNNISGAIPESLSNLTSMAQKDPQNSEDYMSAWYNNNVGTFRQVWHVVMKRQELKYGAGIFDVVGIDLSLNHLIGEIPEMITSLGGLLNLNLSWNHLSGKIPGKIGAMKSVESLDLSRNNLYGEIPASLSELTFLSSLDLSYNNLTGIIPRGSQLDTIYIEN

ProfileScan: PS51450
IPR001611
408-429 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLDILDLSYNNITGAIPLGIGN

HMMPfam: PF00560
IPR001611
410-429 LRR_1
Leucine-rich repeat

DILDLSYNNITGAIPLGIGN

ProfileScan: PS51450
IPR001611
432-454 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRYLVLSHNLLSGHVPSKIGML

ProfileScan: PS51450
IPR001611
456-477 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLIDLDLSNNNLDGLFTREHMV

FPrintScan: PR00019
457-470 LEURICHRPT,Leucine-rich repeat signature

LIDLDLSNNNLDGL

ProfileScan: PS51450
IPR001611
481-502 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRHMDLSHNSFSGPLPIETRA

HMMPfam: PF00560
IPR001611
481-497 LRR_1
Leucine-rich repeat

NLRHMDLSHNSFSGPLP

Gene3D: G3DSA:3.80.10.10
503-650 G3DSA:3.80.10.10

QFLKELTLSSNYFSGHIPESICQLRNLLVLDLSDNFLEGELPHCSHKPNLVFLLLSNNGFSGKFPSSLRNYSSLAFMDLSWNNLYGTLPFWIEELVNLRFLQLSHNLLYGDIPVTITNLQHLHQLSLAGNNISGAIPESLSNLTSMAQ

ProfileScan: PS51450
IPR001611
504-526 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLKELTLSSNYFSGHIPESICQL

HMMPfam: PF00560
IPR001611
505-525 LRR_1
Leucine-rich repeat

LKELTLSSNYFSGHIPESICQ

HMMPfam: PF00560
IPR001611
528-547 LRR_1
Leucine-rich repeat

NLLVLDLSDNFLEGELPHCS

ProfileScan: PS51450
IPR001611
528-550 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLLVLDLSDNFLEGELPHCSHKP

ProfileScan: PS51450
IPR001611
551-573 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVFLLLSNNGFSGKFPSSLRNY

ProfileScan: PS51450
IPR001611
599-622 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRFLQLSHNLLYGDIPVTITNLQ

HMMPfam: PF00560
IPR001611
623-645 LRR_1
Leucine-rich repeat

HLHQLSLAGNNISGAIPESLSNL

ProfileScan: PS51450
IPR001611
623-646 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLHQLSLAGNNISGAIPESLSNLT

Gene3D: G3DSA:3.80.10.10
696-789 G3DSA:3.80.10.10

IDLSLNHLIGEIPEMITSLGGLLNLNLSWNHLSGKIPGKIGAMKSVESLDLSRNNLYGEIPASLSELTFLSSLDLSYNNLTGIIPRGSQLDTIY

ProfileScan: PS51450
IPR001611
716-738 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLLNLNLSWNHLSGKIPGKIGAM

HMMPfam: PF13516
739-760 LRR_6,Leucine Rich repeat

KSVESLDLSRNNLYGEIPASLS

ProfileScan: PS51450
IPR001611
740-763 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SVESLDLSRNNLYGEIPASLSELT

HMMPfam: PF13516
762-778 LRR_6,Leucine Rich repeat

LTFLSSLDLSYNNLTGI

FPrintScan: PR00019
762-775 LEURICHRPT,Leucine-rich repeat signature

LTFLSSLDLSYNNL

ProfileScan: PS51450
IPR001611
764-785 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSSLDLSYNNLTGIIPRGSQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox