PRGDB00047563 (disease resistance protein homolog)

From PRG Wiki
Jump to: navigation, search
disease resistance protein homolog
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 5006599 (AF141015)
Gene Class NL
Domain Type NBS, LRR
Gene Species Vigna vexillata

Comment?

Vigna vexillata disease resistance protein homolog gene, partial cds.

DNA Sequence

CAACACTCGCTTTAGCACTTTATAATTTGATTGCTGACTGTTTTGATAGTTCTTGTTTTGTTCAAAACGTGAGAGAGAAATCAAAAAAGCATGGGCTGGAACACCTCCAAAGCATTCTTCTTTCGAACCTACTTGGAGCGAAGGACATCAACTTAACAAGTGAGCATCAAGGGATTTCAATGATACAACAAAGGTTGCAGCGAAAGAAGGTTCTCTTGATTCTTGATGACGTTGACAGGTACGAGCAGCTACAGACACTGGCTGGAAGCCCTGATTGGTTTGGTCCCGGCAGCAGGATCATCATTACAACTAGAGG


Protein sequences

Name Description Sequence
disease resistance protein homolog disease resistance protein homolog [Vigna vexillata].

TLALALYNLIADCFDSSCFVQNVREKSKKHGLEHLQSILLSNLLGAKDINLTSEHQGISMIQQRLQRKKVLLILDDVDRYEQLQTLAGSPDWFGPGSRIIITTRG


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-104 SSF52540

TLALALYNLIADCFDSSCFVQNVREKSKKHGLEHLQSILLSNLLGAKDINLTSEHQGISMIQQRLQRKKVLLILDDVDRYEQLQTLAGSPDWFGPGSRIIITTR

HMMPanther: PTHR11017:SF20
1-103 PTHR11017:SF20,SUBFAMILY NOT NAMED

TLALALYNLIADCFDSSCFVQNVREKSKKHGLEHLQSILLSNLLGAKDINLTSEHQGISMIQQRLQRKKVLLILDDVDRYEQLQTLAGSPDWFGPGSRIIITT

HMMPanther: PTHR11017
1-103 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TLALALYNLIADCFDSSCFVQNVREKSKKHGLEHLQSILLSNLLGAKDINLTSEHQGISMIQQRLQRKKVLLILDDVDRYEQLQTLAGSPDWFGPGSRIIITT

HMMPfam: PF00931
IPR002182
2-104 NB-ARC,NBS
NB-ARC

LALALYNLIADCFDSSCFVQNVREKSKKHGLEHLQSILLSNLLGAKDINLTSEHQGISMIQQRLQRKKVLLILDDVDRYEQLQTLAGSPDWFGPGSRIIITTR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox