PRGDB00047580 (pNd4)

From PRG Wiki
Jump to: navigation, search
pNd4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3176748 (U97220)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein homolog (pNd4) gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAGACAACACTTCTCACTCAGCTCTTCAATATGTTCAATAAGGATAAGTGTGGATTTGATATTGGCATTAGGGTTGTCGTGTCTCAAGAGGTTAATGTGGAGAAGATTCAAGATGAAATCGCTCAAAAGCTTGGTCTTGGTGGACATGAGTGGACACAGAGAGATATAAGTCAAAAGGGCGTTCATTTATTCAATTTCTTGAAGAACAAGAAATTTGTGTTGTTTTTAGATGACTTATGGGATAAGGTGGAGTTAGCTAATATCGGTGTTCCGGATCCAAGAACACAAAAAGGATGTAAATTGGCATTCACCAGTCGGTCCCTAAATGTATGCACAAGCATGGGGGATGAAGAACCAATGGAAGTTCAATGCTTGGAAGAGAATGTGGCATTTGATTTGTTCCAAAAGAAGGTTGGACAAAAAACACTTGGAAGCGATCCGGGGATCCCCCAAATTGCAAGAATAGTTGCGAAAAAATGTTGTGGTTTCCCCCTCGCCCTC


Protein sequences

Name Description Sequence
disease resistance protein homolog disease resistance protein homolog [Arabidopsis thaliana].

GGVGKTTLLTQLFNMFNKDKCGFDIGIRVVVSQEVNVEKIQDEIAQKLGLGGHEWTQRDISQKGVHLFNFLKNKKFVLFLDDLWDKVELANIGVPDPRTQKGCKLAFTSRSLNVCTSMGDEEPMEVQCLEENVAFDLFQKKVGQKTLGSDPGIPQIARIVAKKCCGFPLAL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-105 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLLTQLFNMFNKDKCGFDIGIRVVVSQEVNVEKIQDEIAQKLGLGGHEWTQRDISQKGVHLFNFLKNKKFVLFLDDLWDKVELANIGVPDPRTQKGCKL

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

GGVGKTTLLTQLFNMFNKDKCGFDIGIRVVVSQEVNVEKIQDEIAQKLGLGGHEWTQRDISQKGVHLFNFLKNKKFVLFLDDLWDKVELANIGVPDPRTQKGCKLAFTSRSLNVCTSMGDEEPMEVQCLEENVAFDLFQKKVGQKTLGSDPGIPQIARIVAKKCCGFPLAL

HMMPanther: PTHR23155:SF120
1-105 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

GGVGKTTLLTQLFNMFNKDKCGFDIGIRVVVSQEVNVEKIQDEIAQKLGLGGHEWTQRDISQKGVHLFNFLKNKKFVLFLDDLWDKVELANIGVPDPRTQKGCKL

superfamily: SSF52540
1-171 P-loop containing nucleoside triphosphate hydrolases

GGVGKTTLLTQLFNMFNKDKCGFDIGIRVVVSQEVNVEKIQDEIAQKLGLGGHEWTQRDISQKGVHLFNFLKNKKFVLFLDDLWDKVELANIGVPDPRTQKGCKLAFTSRSLNVCTSMGDEEPMEVQCLEENVAFDLFQKKVGQKTLGSDPGIPQIARIVAKKCCGFPLAL

Gene3D: G3DSA:3.40.50.300
2-112 no description

GVGKTTLLTQLFNMFNKDKCGFDIGIRVVVSQEVNVEKIQDEIAQKLGLGGHEWTQRDISQKGVHLFNFLKNKKFVLFLDDLWDKVELANIGVPDPRTQKGCKLAFTSRSL

Seg: seg
67-83 seg

LFNFLKNKKFVLFLDDL


List of References

E Speulman, D Bouchez, E B Holub, J L Beynon
Disease resistance gene homologs correlate with disease resistance loci of Arabidopsis thaliana.
Plant J.: 1998, 14(4);467-74
PubMed:9670562 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox