PRGDB00047582 (pNd2)

From PRG Wiki
Jump to: navigation, search
pNd2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3176744 (U97218)
Gene Class TNL
Domain Type LRR, NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein homolog (pNd2) gene, partial cds.

DNA Sequence

GGTGGGGTTGGGAAGACGACCATTGCAAGAGCTTTACGTGATCAAATCTCTGAAAATTTTCAGTTGACTGCGTTTATAGACGATATCAGACTAACCTACCCGAGACGTTGCTACGGTGAGAGTGGTCTGAAACCGCCAACTGCGTTCATGAATGATGACCGAAGGAAGATTGTCTTACAAACGAACTTTTTGTCTGAAATATTAAACCAAAAAGATATCGTAATTCATAATCTAAATGCGGCGCCGAATTGGCTCAAAGACCGAAAAGTTCTTGTCATTCTTGATGACGTGGATCATTTAGAGCAACTAGATGCAATGGCGAAAGAAACTGGGTGGTTCGGCTATGGGAGTAGGATTATCATCACAACACAAGATCGAAAACTTTTGAAGGCACATAATATCGACTATATCTACGAGGTGGGACTCCCCCTCGCCCTC


Protein sequences

Name Description Sequence
disease resistance protein homolog disease resistance protein homolog [Arabidopsis thaliana].

GGVGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEVGLPLAL


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-130 SSF52540

GGVGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLK

HMMPfam: PF00931
IPR002182
1-140 NB-ARC,NBS
NB-ARC

GGVGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEV

Gene3D: G3DSA:3.40.50.300
2-143 G3DSA:3.40.50.300

GVGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEVGLP

HMMPanther: PTHR23155
2-119 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRI

HMMPanther: PTHR23155:SF300
2-119 PTHR23155:SF300

GVGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRI


List of References

E Speulman, D Bouchez, E B Holub, J L Beynon
Disease resistance gene homologs correlate with disease resistance loci of Arabidopsis thaliana.
Plant J.: 1998, 14(4);467-74
PubMed:9670562 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox