PRGDB00047583 (pNd1)

From PRG Wiki
Jump to: navigation, search
pNd1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3176742 (U97217)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein homolog (pNd1) gene, partial cds.

DNA Sequence

GGTGGGGTAGGGAAGACAACGTTAATGCAGAGCGTTAACAACGAGCTGATCACAAAAGGACATCAGTATGATGTACTGATTTGGGTTCAAATGTCCAGAGAATTCGGCGAGTGTACAATTCAGCAAGCCGTTGGAGCACGGTTGGGTTTATCTTGGGACGAGAAGGAGACCGGCGAAAACAGAGCTTTGAAGATATACAGAGCTTTGAGACAGAAACGTTTCTTGTTGTTGCTAGATGATGTCTGGGAAGGGATAGACTTGGAGAAAACTGGAGTTCCTCGACCTGACAGGGAAAACAAATGCAAGGTGATGTTCACGACACGGTCTATAGCATTATGCAACAATATGGGTGCGGAATACAAGTTGAGAGTGGAGTTTCTGGAGAAGAAACACGCGTGGGAGCTGTTCTGTAGTAAGGTATGGAGAAAAGATCTTTTAGAGTCATCATCAATTCGCCGGCTCGCGGAGATTATAGTGAGTAAATGTGGAGGACTCCCCCTCGCCCTC


Protein sequences

Name Description Sequence
disease resistance protein homolog disease resistance protein homolog [Arabidopsis thaliana].

GGVGKTTLMQSVNNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEGIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLAL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-169 P-loop containing nucleoside triphosphate hydrolases

GGVGKTTLMQSVNNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEGIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLAL

HMMPfam: PF00931
IPR002182
1-169 NB-ARC,NBS
NB-ARC

GGVGKTTLMQSVNNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEGIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLAL

HMMPanther: PTHR23155:SF105
1-89 RPS2 (RESISTANT TO P. SYRINGAE 2),RPS2 (RESISTANT TO P. SYRINGAE 2)

GGVGKTTLMQSVNNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEGIDLEK

HMMPanther: PTHR23155
1-89 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLMQSVNNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEGIDLEK

Gene3D: G3DSA:3.40.50.300
2-120 no description

GVGKTTLMQSVNNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEGIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEY

FPrintScan: PR00364
IPR000767
68-82 DISEASERSIST
Disease resistance protein

ALRQKRFLLLLDDVW

FPrintScan: PR00364
IPR000767
162-169 DISEASERSIST
Disease resistance protein

CGGLPLAL


List of References

E Speulman, D Bouchez, E B Holub, J L Beynon
Disease resistance gene homologs correlate with disease resistance loci of Arabidopsis thaliana.
Plant J.: 1998, 14(4);467-74
PubMed:9670562 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox