PRGDB00047585 (pNd10)

From PRG Wiki
Jump to: navigation, search
pNd10
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3176750 (U97221)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein homolog (pNd10) gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAAACGACACTACTCACGAAGATCAACAATAAGTTTTCTAAAATAGATGACAGATTTGATGTTGTGATATGGGTTGCTGTGTCTAGAAGTTCAACAGTCCGTAAGATACAAAGAGACATAGCAGAGAAGGTAGGCCTTGGGGGAATGGAGTGGAGCGAGAAAAACGATAACCAGATAGCCGTTGACATCCACAATGTCCTTAGGAGACGAAAGTTTGTTTTATTGTTGGATGACATATGGGAGAAAGTGAATTTAAAAGTGGTTGGGGTCCCGTATCCAAGCAAAGATAACGGATGCAAGGTAGCATTCACTACTCGTTCTCGAGATGTGTGTGGGCGCATGGGGGTTGATGATCCGATGGAAGTTAGCTGTCTACAACCCGAAGAATCTTGGGATTTGTTTCAAATGAAGGTTGGGAAAAATACACTGGGAAGTCACCCAGCCATTCCCGGACTTGCTAGAAAAGTCGCTAGGAAATGTCGTGGGCTCCCCCTCGCCCTC


Protein sequences

Name Description Sequence
disease resistance protein homolog disease resistance protein homolog [Arabidopsis thaliana].

GGVGKTTLLTKINNKFSKIDDRFDVVIWVAVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKVVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPAIPGLARKVARKCRGLPLAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-102 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLLTKINNKFSKIDDRFDVVIWVAVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKVVGVPYPSKDNG

superfamily: SSF52540
1-171 P-loop containing nucleoside triphosphate hydrolases

GGVGKTTLLTKINNKFSKIDDRFDVVIWVAVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKVVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPAIPGLARKVARKCRGLPLAL

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

GGVGKTTLLTKINNKFSKIDDRFDVVIWVAVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKVVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPAIPGLARKVARKCRGLPLAL

HMMPanther: PTHR23155:SF119
1-102 RFL1 (RPS5-LIKE 1); ATP BINDING / PROTEIN BINDING,RFL1 (RPS5-LIKE 1)

GGVGKTTLLTKINNKFSKIDDRFDVVIWVAVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKVVGVPYPSKDNG

Gene3D: G3DSA:3.40.50.300
2-84 no description

GVGKTTLLTKINNKFSKIDDRFDVVIWVAVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIW

FPrintScan: PR00364
IPR000767
70-84 DISEASERSIST
Disease resistance protein

VLRRRKFVLLLDDIW

FPrintScan: PR00364
IPR000767
164-171 DISEASERSIST
Disease resistance protein

CRGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox