PRGDB00047590 (disease resistance protein RPP1-like protein R8)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP1-like protein R8
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 215261574 (FJ446580)
Gene Class TNL
Domain Type LRR, LRR, NBS, Ser-Thr Kinase, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP1-like protein R1, disease resistance protein RPP1-like protein R2, disease resistance protein RPP1-like protein R3, disease resistance protein RPP1-like protein R4, disease resistance protein RPP1-like p

DNA Sequence

ATGGGTTCTGCAATGAGCTTGAGCTGTTCCAAGAGGAAAACAACGAGTCAGGATGTTGATTCCGAATCTCGTAAAAGACGAAAGATATGCTCAACAAACGATGCTGAGAATTGCAGATTCATTCAGGATGAGTCATCTTGGAAACATCCATGGAGTTTATGTGTCAACGTGGCAGCCGCAGCTTTTACAAAATTCAGATTCCAACAAGACAACAAATATACTAAATCTTCTGCTTTATCTCTTCCATCTCCTCCAACTTCAGTGTCTCGAATCTGGAAACACCACGTCTTCCCGAGCTTCCACGGGGCAGATGTTCGAAAAACCATTCTTAGTCACATCCTCGAATCGTTCAGAAGAAAGGGAATTGACCCATTTATTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCATGAGCTCAAAGAAGCTATCAAAGGATCAAAGATCGCGATCGTCTTGCTCTCAAAGAACTATGCTTCTTCATCTTGGTGCCTTGATGAATTAGCAGAAATCATGAAGTGTAGGGAATTGTTGGGTCAGATAGTCATGACTATTTTCTATGAAGTGGATCCAACTGACATAAAGAAACAGACCGGTGAATTTGGAAAAGCCTTCACAAAAACATGTAAAGGTAAAACAAAAGAGTATGTTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCCACAATCGCCGGAGAACATTCTCGCAACTGGAGGAATGAAGCAGACATGATTGAGAAAATAGCCACTGATGTTTCAAACATGTTAAATAGTTTCACACCATCAAGAGATTTCGACGGGTTAGTAGGGATGAGAGCTCATATGGATATGCTGGAACAATTGTTGCGCCTAGATTTGGATGAAGTAAGGATGATCGGGATTTGGGGACCGCCTGGGATTGGTAAGACAACTATCGCCAGATTTCTGTTTAATCAAGTCTCCGACAGATTCCAACTTAGTGCCATCATTGTGAATATCAGAGGAATCTATCCAAGACCTTGTTTCGATGAGTACAGTGCACAATTGCAACTACAAAACCAAATGTTGTCCCAGATGATCAATCATAAAGATATCATGATTTCTCATTTAGGAGTGGCTCAAGAACGGTTGAGAGACAAGAAAGTGTTTCTTGTTCTCGATGAAGTGGATCAATTAGGACAACTAGATGCCTTGGCGAAAGAAACTCGATGGTTTGGTCCTGGAAGTCGGATTATTATCACAACAGAAGATCTAGGAGTTTTGAAGGCTCATGGGATAAATCATGTTTACAAAGTGAAATATCCATCAAATGACGAGGCTTTTCAAATCTTCTGTATGAATGCCTTTGGTCAGAAACAACCACATGAAGGTTTCGATGAGATTGCTAGGGAAGTTATGGCTTTAGCTGGTGAACTCCCTTTGGGATTGAAGGTTCTAGGCTCTGCTTTGCGGGGGAAGTCCAAGCCAGAGTGGGAAAGAACACTACCAAGGTTAAAAACTAGCCTCGACGGAAATATCGGGAGCATTATACAGTTCAGTTACGATGGCTTATGTGACGAAGATAAATATCTATTTCTTTATATAGCCTGCCTTTTTAAAGACGAATTATCAACCAAAGTGGAAGAGGTTCTTGCAAACAAGTTCTTGGATGTGAAACAAGGTCTTCACGTATTAGCTCAGAAATCTCTCATATCCATTGATGAGAATTCCTTTTATGGAGACACAATAAATATGCATACTTTGCTCAGACAATTCGGAAGAGAAACTTCTCGTAAGCAATTCGTTTATCATGGCTTTACGAAACGTCAGCTTTTGGTTGGTGAAAGGGATATATGTGAAGTACTTAGTGACGATACAATAGATAGTAGACGTTTTATAGGGATACATTTGGATTTATATAAGAGTGAGGAAGAATTGAATATAAGTGAGAAAGTACTTGAAAGAGTGCATGATTTTCATTTCGTGAGAATCGATGCTAGTTTTCAACCTGAGAGACTGCAGTTAGCACTACAAGATTTGATTTGTCATTCTCCAAAGATTAGATCACTGAAGTGGTATAGTTACCAGAATATATGTTTGCCTTCTACTTTTAATCCGGAGTTTCTCGTCGAACTACATATGAGTTTCAGCAAGCTTCGGAAGCTATGGGAAGGAACTAAACAACTTAGAAATCTCAAGTGGATGGATTTGAGTAATTCTGAAGACTTGAAAGAGCTTCCCAATCTTTCAACTGCAACTAATCTCGAAGAATTGAAGCTTAGAGATTGCTCAAGTTTAGTGGAGCTCCCCTCCTCTATTGAAAAACTCACCAGTCTCCAGAGATTATATCTCCAAAGGTGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGAATGCAACTAAACTTGAGGAACTATATCTTGAAAATTGTTCGAGTCTTGAGAAGCTCCCACCATCTATCAATGCCAATAATCTTCAGCAATTGTCTCTAATAAATTGTTCACGTGTTGTGGAGCTCCCCGCTATTGAGAATGCGACTAATCTCCAGGTATTGGATCTCCATAATTGCTCAAGTCTACTAGAGCTCCCTCCTTCTATTGCATCTGCTACAAATCTGAAGAAATTAGATATTAGCGGATGCTCAAGTCTCGTGAAACTCCCATCCTCTATTGGAGATATGACTAATCTCGATGTGTTAGATCTATCTAACTGCTCAAGTTTAGTGGAGCTTCCAATCAACATCAACTTGAAAAGTTTTCTCGCAGTTAATCTCGCAGGTTGCTCGCAGTTGAAAAGTTTTCCTGAGATCTCCACAAAGATCTTCACAGATTGCTATCAGAGAATGTCTCGTTTACGTGATCTTAGAATCAACAACTGCAATAATCTGGTATCACTCCCCCAACTTCCAGACTCCCTTGCTTACTTATATGCAGATAATTGTAAGTCCCTCGAGAGACTGGATTGTTGCTTTAACAATCCAGAGATTAGTCTCAATTTCCCCAAATGCTTCAAACTGAATCAAGAGGCCAGAGATCTCATCATGCACACAACTTGTATAAATGCGACGTTACCCGGGACACAAGTGCCTGCCTGCTTCAATCACAGAGCTACTTCTGGGGATTCATTGAAAATCAAGTTGAAGGAGTCGTCTCTTCCTACAACCTTGAGATTTAAGGCTTGTATCATGCTTGTTAAGGTTAATGAAGAAATGAGTTCTGATCTGAAATCGATGAGTTTTGATCCGATGCGTGTAGACATTGTCATCAGGGACGAACAGAATGATCTCAAAGTTCAGTGTACACCAAGCTATCATTTTATAAATCATTTTATCATTTCAACAGAGCATATATACACATTTGAACTTGAAGTAGAGGAGGTGACTTCCACGGAGCTTGTCTTTGAGTTCACACTAGACAAGGAAAGCAATTGGAAACGAAATTGGAAGATAGGAGAATGCGGGATACTCCAAAGAGAAACGAGATCACTTCGCCGGAGCTCTTCGCCGGATCTCTCGCCGGAATCTTCTCGTGCGTTCTCTCTCTCTCACTCTCCCCTTCTATCTCTCTGTCTCTTGGATTGGTTAATGATTCAATTTCTCCTAATGGGTTTCAGGTGTTTCCAGCTGCGACCACTGTTAGAGAGGTTTTCTATTTTTATAAGAGAATAA


Protein sequences

Name Description Sequence
disease resistance protein RPP1-like protein R8 disease resistance protein RPP1-like protein R8 [Arabidopsis thaliana].

MGSAMSLSCSKRKTTSQDVDSESRKRRKICSTNDAENCRFIQDESSWKHPWSLCVNVAAAAFTKFRFQQDNKYTKSSALSLPSPPTSVSRIWKHHVFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGEHSRNWRNEADMIEKIATDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVKYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDGLCDEDKYLFLYIACLFKDELSTKVEEVLANKFLDVKQGLHVLAQKSLISIDENSFYGDTINMHTLLRQFGRETSRKQFVYHGFTKRQLLVGERDICEVLSDDTIDSRRFIGIHLDLYKSEEELNISEKVLERVHDFHFVRIDASFQPERLQLALQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELHMSFSKLRKLWEGTKQLRNLKWMDLSNSEDLKELPNLSTATNLEELKLRDCSSLVELPSSIEKLTSLQRLYLQRCSSLVELPSFGNATKLEELYLENCSSLEKLPPSINANNLQQLSLINCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSSLVKLPSSIGDMTNLDVLDLSNCSSLVELPININLKSFLAVNLAGCSQLKSFPEISTKIFTDCYQRMSRLRDLRINNCNNLVSLPQLPDSLAYLYADNCKSLERLDCCFNNPEISLNFPKCFKLNQEARDLIMHTTCINATLPGTQVPACFNHRATSGDSLKIKLKESSLPTTLRFKACIMLVKVNEEMSSDLKSMSFDPMRVDIVIRDEQNDLKVQCTPSYHFINHFIISTEHIYTFELEVEEVTSTELVFEFTLDKESNWKRNWKIGECGILQRETRSLRRSSSPDLSPESSRAFSLSHSPLLSLCLLDWLMIQFLLMGFRCFQLRPLLERFSIFIRE

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
92-230 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHHVFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATI

Gene3D: G3DSA:3.40.50.10140
92-228 G3DSA:3.40.50.10140

WKHHVFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVA

HMMSmart: SM00255
IPR000157
93-230 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHHVFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATI

HMMPfam: PF01582
IPR000157
96-225 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALE

HMMPanther: PTHR23155:SF296
104-1014 PTHR23155:SF296

DVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGEHSRNWRNEADMIEKIATDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVKYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDGLCDEDKYLFLYIACLFKDELSTKVEEVLANKFLDVKQGLHVLAQKSLISIDENSFYGDTINMHTLLRQFGRETSRKQFVYHGFTKRQLLVGERDICEVLSDDTIDSRRFIGIHLDLYKSEEELNISEKVLERVHDFHFVRIDASFQPERLQLALQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELHMSFSKLRKLWEGTKQLRNLKWMDLSNSEDLKELPNLSTATNLEELKLRDCSSLVELPSSIEKLTSLQRLYLQRCSSLVELPSFGNATKLEELYLENCSSLEKLPPSINANNLQQLSLINCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSSLVKLPSSIGDMTNLDVLDLSNCSSLVELPININLKSFLAVNLAGCSQLKSFPEISTKIFTDCYQRMSRLRDLRINNCNNLVSLPQLPDSLAYLYADNCKSLERLDCCFNNPEISLNFPKCFKLNQEARDLIMHTTCINATLPGTQV

HMMPanther: PTHR23155
104-1014 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGEHSRNWRNEADMIEKIATDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVKYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDGLCDEDKYLFLYIACLFKDELSTKVEEVLANKFLDVKQGLHVLAQKSLISIDENSFYGDTINMHTLLRQFGRETSRKQFVYHGFTKRQLLVGERDICEVLSDDTIDSRRFIGIHLDLYKSEEELNISEKVLERVHDFHFVRIDASFQPERLQLALQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELHMSFSKLRKLWEGTKQLRNLKWMDLSNSEDLKELPNLSTATNLEELKLRDCSSLVELPSSIEKLTSLQRLYLQRCSSLVELPSFGNATKLEELYLENCSSLEKLPPSINANNLQQLSLINCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSSLVKLPSSIGDMTNLDVLDLSNCSSLVELPININLKSFLAVNLAGCSQLKSFPEISTKIFTDCYQRMSRLRDLRINNCNNLVSLPQLPDSLAYLYADNCKSLERLDCCFNNPEISLNFPKCFKLNQEARDLIMHTTCINATLPGTQV

superfamily: SSF52540
147-519 SSF52540

SKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGEHSRNWRNEADMIEKIATDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVKYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDGLCDEDKYLFL

Gene3D: G3DSA:3.40.50.300
255-415 G3DSA:3.40.50.300

MLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLK

HMMPfam: PF00931
IPR002182
276-528 NB-ARC,NBS
NB-ARC

DMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVKYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDGLCDEDKYLFLYIACLFKDE

HMMSmart: SM00382
IPR003593
288-428 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVKYP

FPrintScan: PR00364
IPR000767
291-306 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
369-383 DISEASERSIST
Disease resistance protein

RLRDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
462-476 DISEASERSIST
Disease resistance protein

AGELPLGLKVLGSAL

superfamily: SSF46785
497-609 SSF46785

GNIGSIIQFSYDGLCDEDKYLFLYIACLFKDELSTKVEEVLANKFLDVKQGLHVLAQKSLISIDENSFYGDTINMHTLLRQFGRETSRKQFVYHGFTKRQLLVGERDICEVLS

Gene3D: G3DSA:3.80.10.10
663-978 G3DSA:3.80.10.10

LQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELHMSFSKLRKLWEGTKQLRNLKWMDLSNSEDLKELPNLSTATNLEELKLRDCSSLVELPSSIEKLTSLQRLYLQRCSSLVELPSFGNATKLEELYLENCSSLEKLPPSINANNLQQLSLINCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSSLVKLPSSIGDMTNLDVLDLSNCSSLVELPININLKSFLAVNLAGCSQLKSFPEISTKIFTDCYQRMSRLRDLRINNCNNLVSLPQLPDSLAYLYADNCKSLERLDCCFNN

superfamily: SSF52058
663-973 SSF52058,LRR

LQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELHMSFSKLRKLWEGTKQLRNLKWMDLSNSEDLKELPNLSTATNLEELKLRDCSSLVELPSSIEKLTSLQRLYLQRCSSLVELPSFGNATKLEELYLENCSSLEKLPPSINANNLQQLSLINCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSSLVKLPSSIGDMTNLDVLDLSNCSSLVELPININLKSFLAVNLAGCSQLKSFPEISTKIFTDCYQRMSRLRDLRINNCNNLVSLPQLPDSLAYLYADNCKSLERLD

HMMPfam: PF07725
IPR011713
694-713 LRR_3
Leucine-rich repeat 3

FLVELHMSFSKLRKLWEGTK

HMMPfam: PF00560
IPR001611
740-762 LRR_1
Leucine-rich repeat

NLEELKLRDCSSLVELPSSIEKL

HMMPfam: PF00560
IPR001611
764-784 LRR_1
Leucine-rich repeat

SLQRLYLQRCSSLVELPSFGN

HMMPfam: PF00560
IPR001611
787-806 LRR_1
Leucine-rich repeat

KLEELYLENCSSLEKLPPSI

HMMPfam: PF00560
IPR001611
833-852 LRR_1
Leucine-rich repeat

NLQVLDLHNCSSLLELPPSI

HMMPfam: PF00560
IPR001611
857-877 LRR_1
Leucine-rich repeat

NLKKLDISGCSSLVKLPSSIG

FPrintScan: PR00364
IPR000767
877-893 DISEASERSIST
Disease resistance protein

GDMTNLDVLDLSNCSSL

HMMPfam: PF13504
880-897 LRR_7,Leucine rich repeat

TNLDVLDLSNCSSLVELP

HMMPfam: PF13504
935-952 LRR_7,Leucine rich repeat

SRLRDLRINNCNNLVSLP


List of References

Rubén Alcázar, Ana V García, Jane E Parker, Matthieu Reymond
Incremental steps toward incompatibility revealed by Arabidopsis epistatic interactions modulating salicylic acid pathway activation.
Proc. Natl. Acad. Sci. U.S.A.: 2009, 106(1);334-9
PubMed:19106299 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox