PRGDB00047592 (disease resistance protein RPP1-like protein R6)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP1-like protein R6
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 215261574 (FJ446580)
Gene Class T
Domain Type TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP1-like protein R1, disease resistance protein RPP1-like protein R2, disease resistance protein RPP1-like protein R3, disease resistance protein RPP1-like protein R4, disease resistance protein RPP1-like p

DNA Sequence

ATGGAGAACCGGAGATCGACCGAGATCAACGGTCGAGATGAGAAGATCAAGATATGGCAAGAAGATATTATTCTAGAAGGATATATTGAAGGCAAAGGAGATTTTCCGCCCGAAGCAGATAAGAAGCTTAAGCTAATGTGTTCGTATTGCAAGAAACACGATGACAAGTTTGTTCCTGATCCATATTATGGTGGACCTCAAGGTTTTGAGAGGTACTGGACTTGCTTGAAGATGCTTTTGAGTCTTTGCTGGATAATATCCCTATGGAAAGTTGATGATATAAAACAAGGAGTACACTCACGCTACGCTGCAGTCGCAGCTGCTATAGGCTTCTTCATACTTTTTCGAAAATTCAGATTCCAAGAAAGTAATTCTTCTTCTTTATCTCTTCCATCTCCTGCAACTTCTGTGTCTCGAAACCGGAAACACGATGTCTTCCCTAGCTTCCACGGGGCAGATGTTCGAAAAACCATTCTTAGTCACATCCTGGAGTCGTTCAGAAGAAAGGGAATCGACACATTCAGTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCTTGAGCTTAAAGAGGCCATCCGAGGATCGAAGATCGCGATCGTCTTGCTCTCCAAAAACTATGCTTCTTCTTCGTGGTGTCTTGATGAGTTGGCGGAGATCATGAAGTGTAGGGAATTGTTGGGTCAGATAGTCATGACTATCTTCTATGAAGTTGATCCAACTGACATAAAGAAACAAACCGGAGATTTTGGAAAAGCCTTTAAGAAAACATGTAACGGTAAAACCAAAGAGCATGTTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCCACAATCGCCGGAGAACATTCTCGCAACTGCCTCAATGAATTCCCGCATGCTCTTGACATCATCACGGAGCTGCAGTTGAGCAAAGACATACAAGAAGTTCCTCCATGGGTCAAGAGAATGTCTCGTTTACGTGTTCTTAGACTCAACAACTGCAATAATCTGGTATCACTCCCCCAACTTTCAGATTCCCTTGATTACATATATGCAGATAATTGTAAGTCCCTCGAGAGACTGGATTGTTGCTTTAACAATCCAGAGATCCGTCTCTATTTCCCCAAATGCTTCAAACTGAATCAAGAAGCCAGAGATCTCATCATGCACACATCACCTTGTATAGATGCGATGTTTCCAGGTACACAAGTGCCTGCCTGCTTCAATCACAGAGCTACTTCTGGGGATTCCTTGAAAATCAAGTTGAAGGAGTCGCCTCTTCCTAGAACCTTGAGATTTAAGGCTTGTATCATGCTTGTTAAGGGTAATGAAGAAATGAGATATGATGAGATATTGATGAGCGTTGACATTGTCATCAGGGACGAACAGAATGATCTCAAAGTTCATTGCTATCATCTTATAAATCCACTTTTAACAGAGCATATATACACATTTGAACTTGAAGTAGAGGAGGTGACTTCCACGGAGCTTGTCTTTGAGTTCACATCATACAACGAAAGCAATTGGAAGATAGGAGAATGCGGGATACTCCAAATCGTGGAGGTCCCTTGA


Protein sequences

Name Description Sequence
disease resistance protein RPP1-like protein R6 disease resistance protein RPP1-like protein R6 [Arabidopsis thaliana].

MENRRSTEINGRDEKIKIWQEDIILEGYIEGKGDFPPEADKKLKLMCSYCKKHDDKFVPDPYYGGPQGFERYWTCLKMLLSLCWIISLWKVDDIKQGVHSRYAAVAAAIGFFILFRKFRFQESNSSSLSLPSPATSVSRNRKHDVFPSFHGADVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNCLNEFPHALDIITELQLSKDIQEVPPWVKRMSRLRVLRLNNCNNLVSLPQLSDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTSPCIDAMFPGTQVPACFNHRATSGDSLKIKLKESPLPRTLRFKACIMLVKGNEEMRYDEILMSVDIVIRDEQNDLKVHCYHLINPLLTEHIYTFELEVEEVTSTELVFEFTSYNESNWKIGECGILQIVEVP

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.270
35-76 G3DSA:3.40.50.270

FPPEADKKLKLMCSYCKKHDDKFVPDPYYGGPQGFERYWTCL

superfamily: SSF52200
IPR000157
131-282 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PSPATSVSRNRKHDVFPSFHGADVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGE

Gene3D: G3DSA:3.40.50.10140
139-277 G3DSA:3.40.50.10140

RNRKHDVFPSFHGADVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVA

ProfileScan: PS50104
IPR000157
141-279 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RKHDVFPSFHGADVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATI

HMMSmart: SM00255
IPR000157
142-279 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFPSFHGADVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATI

HMMPfam: PF01582
IPR000157
145-274 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALE

Gene3D: G3DSA:3.80.10.10
284-360 G3DSA:3.80.10.10

SRNCLNEFPHALDIITELQLSKDIQEVPPWVKRMSRLRVLRLNNCNNLVSLPQLSDSLDYIYADNCKSLERLDCCFN

HMMPanther: PTHR23155
288-397 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LNEFPHALDIITELQLSKDIQEVPPWVKRMSRLRVLRLNNCNNLVSLPQLSDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTSPCIDAMFPGTQ

HMMPanther: PTHR23155:SF296
288-397 PTHR23155:SF296

LNEFPHALDIITELQLSKDIQEVPPWVKRMSRLRVLRLNNCNNLVSLPQLSDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTSPCIDAMFPGTQ


List of References

Rubén Alcázar, Ana V García, Jane E Parker, Matthieu Reymond
Incremental steps toward incompatibility revealed by Arabidopsis epistatic interactions modulating salicylic acid pathway activation.
Proc. Natl. Acad. Sci. U.S.A.: 2009, 106(1);334-9
PubMed:19106299 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox