PRGDB00047593 (disease resistance protein RPP1-like protein R5)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP1-like protein R5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 215261574 (FJ446580)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP1-like protein R1, disease resistance protein RPP1-like protein R2, disease resistance protein RPP1-like protein R3, disease resistance protein RPP1-like protein R4, disease resistance protein RPP1-like p

DNA Sequence

ATGTCATACTCTGAAAGCCTCATGGAATTCCCACATGCCCTTGACATCATCACGGAGCTGCAGTTGAGCAAAGATATACAAGAAGTTCCTCCATGGGTAAAGGGAATGTCTCGTTTACGTGTACTTAGACTCTACGATTGCAACAATCTGGTATCACTCCCACAACTTTCCGATTCCCTATCTTGGATAGATGCAAATAACTGTAAGTCTCTTGAGAGAATGGATTGTTGCTTTAATAATCCAGAGATTCGTCTCCAGTTCGCCAACTGCTTCAAACTGAATCAAGAAGCAAGAGACCTCATCATGCACACATCGACTTCTAGATATACGATGTTACCCGTGGCAGCCGCAGCTTTTACAAAGTTCAGATTCCAACAAGACAACAAAGATACTATATCTTCAGTTTTAGCTCTTCCATGTCCTCCAACTTCAGTGTCTCGAATCTGGAAACACCACGTCTTCCCGAGCTTCCACGGGGAAGATGTTCGAAAAACCATTCTTAGTCACATCCTGGAGTCGTTCAGAAGAAAGGGAATCGACACATTCAGTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCTTGAGCTTAAAGAGGCCATCCGAGGATCGAAGATCGCGATCGTCTTGCTCTCCAAAAACTATGCTTCTTCTTCGTGGTGTCTTGATGAGTTGGCGGAGATCATGAAGTGTAGGGAATTGTTGGGTCAGATAGTCATGACTATCTTCTATGAAGTTGATCCAACTGACATAAAGAAACAAACCGGAGATTTTGGAAAAGCTTTTAAGAAAACATGTAACGGTAAAACCAAAGAGCATGTTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCCACAATCGCCGGAGAACATTCTCGCAACTGGAGGAATGAAGCAGCCATGATTGAGAAAATAGCCACTAATGTTTCAAACATGTTAAATAGTTGCACACCATCAAGAGATTTCGACGGGTTAGTAGGGATGAGAGCTCATATGGATAGGATGGAGCATTTGTTACGCCTAGATTTGGATGAAGTAAGAATGATCGGGATTTGGGGACCGCCTGGGATCGGTAAGACAACTATCGCCAGATTTCTGTTTAACCAAGTCTCCGACAGATTCCAACTTAGTGCCATCATTGTGAATATCAGAGGAATCTATCCAAGACTTCGTTTGGATGAGTACAGTGCACAAATGGAAGTCCAGCAAAAAATGTTGTCTACGATTTTCAGTCAAAAAGATATCATTGTTCCTAATTTAGGAGTGGCACAAGAGCGGTTAAAGGACAAGAAAGTGTTTCTCGTTCTCGATGAAGTGGATCACATCAGACAGCTAGATGCCTTGGCGAAAGAAACTCGGTGGTTTGGTCCCGGAAGTCGGATTATCATTACAACAGAAGATGTTAGAGTTTTGAACGCGCATAGGATCAATCATGTTTACAAAGTGAAATTTCCATCAAGTGATGAGGCTTTTCAAATCTTTTGTATGAATGCCTTTGGTCAGAAACAACCACATGAGGGTTTCTGTAAGCTTGCTTGGGAAGTTATGGCCTTAGCTGGCAATCTCCCTTTGGGATTGAAGGTTTTAGGCTCCGCTCTGCGTGGAATGTCCAAGCCAGAGTGGGAAAGGACACTACCGAAGATAAAATATTGCCTTGATGGAGAAATAAAGAGCATTATAAAGTTCAGCTTTGATGCCTTATGTGATGAAGATAAAGATTTATTTCTTTATATAGCTTGCTTTTTCAACGGTATAAAACTTCATAAAGTGGAAGGGGTTCTTGCAAAGAAGTTCTTGGATGTGAGGCAAAGTCTTCATGTCTTAGTTGAGAAATCTCTCATATCTATCAACCAATCCGGATTAATAGAGACACATACTGTGCTAAAACAATTTGGAAGAGAAACTTCACGTAAGCAATTCGTTCATGGCTTTGCGAAACCTCAATTTTTGGTTGATGCAAGAGATATATGTGAAGTTCTCAATGACGATACAATAGCGTTTTATAGGGATTATACTGAGGAAGAATTGAGTATAAGTGAGAAAGCACTTGAGAGAATGCATGATTTTCAATTCGTTAGAATCAACGCCTTTGCTCATCCAGAGAGACTTCACTCACTCCTTCATCATTCTCAAAAGATTAGATTACTGCATTGGAGTTATTTGAAGGATATATGTTTGCCTTGTACTTTTAATCCGGAGTTTCTCGTCGAACTAGGTATGTATGCCAGCAAGCTTCACAAGCTATGGGAGGGAACTAAACAACTTCAAAATCTCAGGTGGATGGATTTGTGTTATTCGAGAGATCTGACAAAGCTTCCGGATCTTTCAACTGCTACTAATCTTGAAGACTTAATTCTTAGAAATTGCTCAAGTCTGGTGAGAATCCCTTGTTCTATTGAGAATGCGACCAATCTCCAGATATTAGATCTCTCTGATTGCTCAAATCTTGTTGAGCTTCCCTCTATTGGGAATGCAACTAGACTTGAGGAATTGAATCTTAACAATTGCTCAAGTCTTGTGAAGCTCCCTTCCTCTATCAATGCTACTAATCTTCAGAAATTGTTTCTAAGAAATTGTTCACGTGTTGTGGAGCTTCCCGCTATTGAGAATGCGACTAATCTCCAGGTATTGGATCTCCATAATTGCTCAAGTCTACTAGAGCTCCCTCCTTCTATTGCATCTGCTACAAATCTGAAGAAATTAGATATTAGCGGATGCTCGCAGTTGAAATGTTTTCCAGAGATCTCCACAAACATTGAGATTGTCAACCTTATAGAAACTGCAATAAAAGAAGTTCCTTTGTCGATCATGTCGTGGTCTCGTCTTTCTTACTTTGGGATGTCATACTTTGAAAGCCTCAATGAATTTCCGCATGCTCTTGATATCATCACGGACCTGGTTTTGATAAGGGAAGATATACAAGAAATTCCTCCATGGGTCAAGGGAATGTCTCGTTTAGGTGTACTTAGACTCTACGACTGCAAAAATCTGGTATCACTCCCACAACTTTCAGATAACCTTGAGTACATAGTTGCAGATAATTGTCAGTCCCTTGAGAGACTGGATTGTTGCTTCAACAATCGAGAGATTCATCTCATCTTCCCCAACTGCTTTAATTTGAATCAAGAAGCAAGAGACCTCATCATGCACACATCGACTGATGGATATGCGATATTTTCGGGGACACAAGTGCCTGCCTGCTTCAATCACCGAGCTACTTCTGATTCCTTGAAAATCAAATTGAATGAGTCGCCTCTTCCTACATCCTTGAGATTTAAGGCTTGTATCATGCTTGTTAAGGTTAATGAAGAAACTAGTAATGATGATAGTTTGACGGTAGTAACTATTGACATCGTGGACAAACAGAATGATCTCGAAGTTCTATGTACACCAAGCAGCCGTTGTATAAATGCACCTTTAACAGAGCATATCTACACATTTGAAGTTAAAGCAGAGGAGGTTAAGCTAATGTGTTCTTATTGCAAGAAACACAATGACAAGTTTGTTCCTGATCCATATTATGGTGGAGCTCAAGGTTTTGAGAAGGTACTGGACTTGCTTGAAGATGCTTGTGAGTCTTTGCTGGATAGTATCACTGCGCAAAGTTGA


Protein sequences

Name Description Sequence
disease resistance protein RPP1-like protein R5 disease resistance protein RPP1-like protein R5 [Arabidopsis thaliana].

MSYSESLMEFPHALDIITELQLSKDIQEVPPWVKGMSRLRVLRLYDCNNLVSLPQLSDSLSWIDANNCKSLERMDCCFNNPEIRLQFANCFKLNQEARDLIMHTSTSRYTMLPVAAAAFTKFRFQQDNKDTISSVLALPCPPTSVSRIWKHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKVEGVLAKKFLDVRQSLHVLVEKSLISINQSGLIETHTVLKQFGRETSRKQFVHGFAKPQFLVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEARDLIMHTSTDGYAIFSGTQVPACFNHRATSDSLKIKLNESPLPTSLRFKACIMLVKVNEETSNDDSLTVVTIDIVDKQNDLEVLCTPSSRCINAPLTEHIYTFEVKAEEVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDLLEDACESLLDSITAQS

disease resistance protein RPP1-like protein R5 disease resistance protein RPP1-like protein R5 [Arabidopsis thaliana].

MSYSESLMEFPHALDIITELQLSKDIQEVPPWVKGMSRLRVLRLYDCNNLVSLPQLSDSLSWIDANNCKSLERMDCCFNNPEIRLQFANCFKLNQEARDLIMHTSTSRYTMLPVAAAAFTKFRFQQDNKDTISSVLALPCPPTSVSRIWKHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKVEGVLAKKFLDVRQSLHVLVEKSLISINQSGLIETHTVLKQFGRETSRKQFVHGFAKPQFLVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEARDLIMHTSTDGYAIFSGTQVPACFNHRATSDSLKIKLNESPLPTSLRFKACIMLVKVNEETSNDDSLTVVTIDIVDKQNDLEVLCTPSSRCINAPLTEHIYTFEVKAEEVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDLLEDACESLLDSITAQS

disease resistance protein RPP1-like protein R5 disease resistance protein RPP1-like protein R5 [Arabidopsis thaliana].

MSYSESLMEFPHALDIITELQLSKDIQEVPPWVKGMSRLRVLRLYDCNNLVSLPQLSDSLSWIDANNCKSLERMDCCFNNPEIRLQFANCFKLNQEARDLIMHTSTSRYTMLPVAAAAFTKFRFQQDNKDTISSVLALPCPPTSVSRIWKHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKVEGVLAKKFLDVRQSLHVLVEKSLISINQSGLIETHTVLKQFGRETSRKQFVHGFAKPQFLVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEARDLIMHTSTDGYAIFSGTQVPACFNHRATSDSLKIKLNESPLPTSLRFKACIMLVKVNEETSNDDSLTVVTIDIVDKQNDLEVLCTPSSRCINAPLTEHIYTFEVKAEEVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDLLEDACESLLDSITAQS

Domains

Domain Start-End Description Sequence

HMMPfam: PF13504
37-54 LRR_7,Leucine rich repeat

SRLRVLRLYDCNNLVSLP

HMMPfam: PF13504
37-54 LRR_7,Leucine rich repeat

SRLRVLRLYDCNNLVSLP

HMMPfam: PF13504
37-54 LRR_7,Leucine rich repeat

SRLRVLRLYDCNNLVSLP

Gene3D: G3DSA:3.40.50.10140
149-285 G3DSA:3.40.50.10140

WKHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVA

ProfileScan: PS50104
IPR000157
149-287 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATI

Gene3D: G3DSA:3.40.50.10140
149-285 G3DSA:3.40.50.10140

WKHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVA

ProfileScan: PS50104
IPR000157
149-287 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATI

ProfileScan: PS50104
IPR000157
149-287 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATI

Gene3D: G3DSA:3.40.50.10140
149-285 G3DSA:3.40.50.10140

WKHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVA

HMMSmart: SM00255
IPR000157
150-287 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATI

HMMSmart: SM00255
IPR000157
150-287 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATI

HMMSmart: SM00255
IPR000157
150-287 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHHVFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATI

HMMPfam: PF01582
IPR000157
153-282 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALE

HMMPfam: PF01582
IPR000157
153-282 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALE

HMMPfam: PF01582
IPR000157
153-282 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGEDVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALE

HMMPanther: PTHR23155
161-1063 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKVEGVLAKKFLDVRQSLHVLVEKSLISINQSGLIETHTVLKQFGRETSRKQFVHGFAKPQFLVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEARDLIMHTSTDGYAIFSGTQ

HMMPanther: PTHR23155:SF296
161-1063 PTHR23155:SF296

DVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKVEGVLAKKFLDVRQSLHVLVEKSLISINQSGLIETHTVLKQFGRETSRKQFVHGFAKPQFLVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEARDLIMHTSTDGYAIFSGTQ

HMMPanther: PTHR23155
161-1063 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKVEGVLAKKFLDVRQSLHVLVEKSLISINQSGLIETHTVLKQFGRETSRKQFVHGFAKPQFLVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEARDLIMHTSTDGYAIFSGTQ

HMMPanther: PTHR23155:SF296
161-1063 PTHR23155:SF296

DVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKVEGVLAKKFLDVRQSLHVLVEKSLISINQSGLIETHTVLKQFGRETSRKQFVHGFAKPQFLVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEARDLIMHTSTDGYAIFSGTQ

HMMPanther: PTHR23155:SF296
161-1063 PTHR23155:SF296

DVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKVEGVLAKKFLDVRQSLHVLVEKSLISINQSGLIETHTVLKQFGRETSRKQFVHGFAKPQFLVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEARDLIMHTSTDGYAIFSGTQ

HMMPanther: PTHR23155
161-1063 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKTILSHILESFRRKGIDTFSDNNIERSKSIGLELKEAIRGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKVEGVLAKKFLDVRQSLHVLVEKSLISINQSGLIETHTVLKQFGRETSRKQFVHGFAKPQFLVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEARDLIMHTSTDGYAIFSGTQ

superfamily: SSF52540
204-576 SSF52540

SKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFL

superfamily: SSF52540
204-576 SSF52540

SKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFL

superfamily: SSF52540
204-576 SSF52540

SKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGDFGKAFKKTCNGKTKEHVERWRKALEDVATIAGEHSRNWRNEAAMIEKIATNVSNMLNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFL

Gene3D: G3DSA:3.40.50.300
313-472 G3DSA:3.40.50.300

LNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLN

Gene3D: G3DSA:3.40.50.300
313-472 G3DSA:3.40.50.300

LNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLN

Gene3D: G3DSA:3.40.50.300
313-472 G3DSA:3.40.50.300

LNSCTPSRDFDGLVGMRAHMDRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLN

HMMPfam: PF00931
IPR002182
333-590 NB-ARC,NBS
NB-ARC

DRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKV

HMMPfam: PF00931
IPR002182
333-590 NB-ARC,NBS
NB-ARC

DRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKV

HMMPfam: PF00931
IPR002182
333-590 NB-ARC,NBS
NB-ARC

DRMEHLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFPSSDEAFQIFCMNAFGQKQPHEGFCKLAWEVMALAGNLPLGLKVLGSALRGMSKPEWERTLPKIKYCLDGEIKSIIKFSFDALCDEDKDLFLYIACFFNGIKLHKV

HMMSmart: SM00382
IPR003593
345-485 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFP

HMMSmart: SM00382
IPR003593
345-485 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFP

HMMSmart: SM00382
IPR003593
345-485 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIIVNIRGIYPRLRLDEYSAQMEVQQKMLSTIFSQKDIIVPNLGVAQERLKDKKVFLVLDEVDHIRQLDALAKETRWFGPGSRIIITTEDVRVLNAHRINHVYKVKFP

FPrintScan: PR00364
IPR000767
348-363 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
348-363 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
348-363 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
426-440 DISEASERSIST
Disease resistance protein

RLKDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
426-440 DISEASERSIST
Disease resistance protein

RLKDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
426-440 DISEASERSIST
Disease resistance protein

RLKDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
519-533 DISEASERSIST
Disease resistance protein

AGNLPLGLKVLGSAL

FPrintScan: PR00364
IPR000767
519-533 DISEASERSIST
Disease resistance protein

AGNLPLGLKVLGSAL

FPrintScan: PR00364
IPR000767
519-533 DISEASERSIST
Disease resistance protein

AGNLPLGLKVLGSAL

superfamily: SSF52058
650-1045 SSF52058,LRR

LVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEAR

superfamily: SSF52058
650-1045 SSF52058,LRR

LVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEAR

superfamily: SSF52058
650-1045 SSF52058,LRR

LVDARDICEVLNDDTIAFYRDYTEEELSISEKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFNNREIHLIFPNCFNLNQEAR

Gene3D: G3DSA:3.80.10.10
680-1026 G3DSA:3.80.10.10

EKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFN

Gene3D: G3DSA:3.80.10.10
680-1026 G3DSA:3.80.10.10

EKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFN

Gene3D: G3DSA:3.80.10.10
680-1026 G3DSA:3.80.10.10

EKALERMHDFQFVRINAFAHPERLHSLLHHSQKIRLLHWSYLKDICLPCTFNPEFLVELGMYASKLHKLWEGTKQLQNLRWMDLCYSRDLTKLPDLSTATNLEDLILRNCSSLVRIPCSIENATNLQILDLSDCSNLVELPSIGNATRLEELNLNNCSSLVKLPSSINATNLQKLFLRNCSRVVELPAIENATNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCFPEISTNIEIVNLIETAIKEVPLSIMSWSRLSYFGMSYFESLNEFPHALDIITDLVLIREDIQEIPPWVKGMSRLGVLRLYDCKNLVSLPQLSDNLEYIVADNCQSLERLDCCFN

FPrintScan: PR00364
IPR000767
800-816 DISEASERSIST
Disease resistance protein

ENATNLQILDLSDCSNL

FPrintScan: PR00364
IPR000767
800-816 DISEASERSIST
Disease resistance protein

ENATNLQILDLSDCSNL

FPrintScan: PR00364
IPR000767
800-816 DISEASERSIST
Disease resistance protein

ENATNLQILDLSDCSNL

HMMPfam: PF00560
IPR001611
804-824 LRR_1
Leucine-rich repeat

NLQILDLSDCSNLVELPSIGN

HMMPfam: PF00560
IPR001611
804-824 LRR_1
Leucine-rich repeat

NLQILDLSDCSNLVELPSIGN

HMMPfam: PF00560
IPR001611
804-824 LRR_1
Leucine-rich repeat

NLQILDLSDCSNLVELPSIGN

HMMPfam: PF00560
IPR001611
827-845 LRR_1
Leucine-rich repeat

RLEELNLNNCSSLVKLPSS

HMMPfam: PF00560
IPR001611
827-845 LRR_1
Leucine-rich repeat

RLEELNLNNCSSLVKLPSS

HMMPfam: PF00560
IPR001611
827-845 LRR_1
Leucine-rich repeat

RLEELNLNNCSSLVKLPSS

HMMPfam: PF12799
872-912 LRR_4,Leucine Rich repeats (2 copies)

TNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCF

HMMPfam: PF12799
872-912 LRR_4,Leucine Rich repeats (2 copies)

TNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCF

HMMPfam: PF12799
872-912 LRR_4,Leucine Rich repeats (2 copies)

TNLQVLDLHNCSSLLELPPSIASATNLKKLDISGCSQLKCF

Gene3D: G3DSA:3.40.50.270
1147-1200 G3DSA:3.40.50.270

FEVKAEEVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDLLEDACESLLDSITA

Gene3D: G3DSA:3.40.50.270
1147-1200 G3DSA:3.40.50.270

FEVKAEEVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDLLEDACESLLDSITA

Gene3D: G3DSA:3.40.50.270
1147-1200 G3DSA:3.40.50.270

FEVKAEEVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDLLEDACESLLDSITA

superfamily: SSF52788
IPR023485
1152-1199 Tyr_Pase_low_mol_wt
Phosphotyrosine protein phosphatase I superfamily

EEVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDLLEDACESLLDSIT

superfamily: SSF52788
IPR023485
1152-1199 Tyr_Pase_low_mol_wt
Phosphotyrosine protein phosphatase I superfamily

EEVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDLLEDACESLLDSIT

superfamily: SSF52788
IPR023485
1152-1199 Tyr_Pase_low_mol_wt
Phosphotyrosine protein phosphatase I superfamily

EEVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDLLEDACESLLDSIT


List of References

Rubén Alcázar, Ana V García, Jane E Parker, Matthieu Reymond
Incremental steps toward incompatibility revealed by Arabidopsis epistatic interactions modulating salicylic acid pathway activation.
Proc. Natl. Acad. Sci. U.S.A.: 2009, 106(1);334-9
PubMed:19106299 WorldCat.org DOI (I p)

Rubén Alcázar, Ana V García, Jane E Parker, Matthieu Reymond
Incremental steps toward incompatibility revealed by Arabidopsis epistatic interactions modulating salicylic acid pathway activation.
Proc. Natl. Acad. Sci. U.S.A.: 2009, 106(1);334-9
PubMed:19106299 WorldCat.org DOI (I p)

Rubén Alcázar, Ana V García, Jane E Parker, Matthieu Reymond
Incremental steps toward incompatibility revealed by Arabidopsis epistatic interactions modulating salicylic acid pathway activation.
Proc. Natl. Acad. Sci. U.S.A.: 2009, 106(1);334-9
PubMed:19106299 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox