PRGDB00047596 (disease resistance protein RPP1-like protein R2)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP1-like protein R2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 215261574 (FJ446580)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP1-like protein R1, disease resistance protein RPP1-like protein R2, disease resistance protein RPP1-like protein R3, disease resistance protein RPP1-like protein R4, disease resistance protein RPP1-like p

DNA Sequence

ATGGGTTCTGCAATGAGCTTGAGCTGTTCCAAGAGGAAAGCAACGAGTCAGGATGTTGATTCCGAATCTTGTAAAAGACGAAAGACATGCTCAACAAACGATGCTGAGAATTGCATATTCATTCCGGATGAGTCATCTTGGAGTTTATGTGCCAACAGAGTCATCAGTGTGGCAGCCGTAGCTTTAACAAAATTCAGATTCCAACAAGATAACCAAGAAAGTAATTCTTCTTCTTTATCTCTTCCCTCCCCTGCAACTTCTGTGTCTCGAAACTGGAAACACGATGTCTTCCCGAGCTTCCACGGAGCAGATGTCCGAAGAACCTTTCTTAGTCACATCATGGAATCGTTCAGAAGAAAGGGAATTGACACATTCATTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCCTGAGCTCAAAAAAGCTATCAAAGGATCAAAGATCGCAATCGTTTTGCTCTCAAGGAAATATGCTTCTTCGTCATGGTGTCTTGATGAGTTGACCGAGATCATGAAATGCAGGGAAGTGTTGGGTCAGATTGTCATGACCATTTTCTATGAAGTGGATCCAACTGATATAAAGAAACAGACCGGTGAATTTGGAAAAGCCTTCACAAAAACATGTAAAGGTAAAACAAAAGAGTATGTTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCAACAATCGCCGGATATCATTCTCACAGCTGGAGGAATGAAGCAGACATGATTGAGAAAATAGCCACTTATGTTTCAAACATGTTAAATAGTTTCACACCATCAAGAGATTTCGACGGGTTAGTAGGGATGAGAGCTCATATGGATATGCTGGAACAATTGTTGCGCCATGATTTGGATGAAGTAAGGATGATCGGGATTTGGGGACCGCCTGGGATTGGTAAGACAACTATCGCCAGATTTCTGCTTAACCAAGTCTCCGACAGATTCCAACTTAGTGCAATCATGGTCAATATCAAAGGATGCTATCCAAGACTTTGTTTGGATGAGCGCAGTGCACAATTGCAACTACAAAACCAAATGTTGTCCCAGATGATCAATCATAAAGATATCATGATTTCTCATTTAGGAGTGGCTCAAGAACGGTTGAGAGACAAGAAAGTGTTTCTTGTTCTCGATGAAGTGGATCAATTAGGACAACTAGATGCCTTGGCGAAAGAAACTCGATGGTTTGGTCCTGGAAGTCGGATTATTATCACAACAGAAGATCTAGGAGTTTTGAAGGCCCATGGGATCAATCATGTTTACAAAGTGGGATATCCATCAAATGACGAGGCTTTTCAAATCTTCTGTATGAATGCCTTTGGTCAGAAACAACCACACGAAGGTTTCGATGAGATTGCTAGGGAAGTTATGGCTTTAGCTGGTGAACTCCCTTTGGGATTGAAGGTTCTAGGCTCTGCTTTGCGGGGGAAGTCCAAGCCAGAGTGGGAAAGAACACTACCAAGGTTAAAAACTAGCCTCGATGGAAATATCGGGAGCATTATACAGTTCAGTTACGATGCTTTATGTGACGAAGATAAATATCTATTTCTTTATATAGCCTGTCTTTTTAACGACGAATCAACAACCAAAGTGAAAGAGCTTCTTGGAAAGTTCTTGGATGCTAGACAAGGTCTTCACATATTAGCTCAGAAATCTCTCATATCCTTTGATGGAGAAAGAATACATATGCATACTCTGCTAGAACAGTTTGGAAGAGAAACTTCCCGTAAGCAATTCGTTTATCATGGCTATACGAAACATCAGCTTTTGGTTGGTGAAAGGGATATATGTGAAGTACTCAATGACGATACAACAGATAGTAGGCGTTTTATAGGGATAAATTTGGATTTATATAAGAATGAGGAAGAATTGAATATAAGTGAGAAAGCACTTGAAAGAATCCATGATTTTCAATTCGTTAAAATCAATGACGTATTTACTCATCAACCTGAGAGAGTGCAGTTAGCACTAGAAGATCTGATTTATCAATCTCCACGAATTAGATCATTGAAATGGTTTCCTTACCAGAATATATGTTTGCCTTCTACTTTTAATCCGGAGTTTCTCGTCGAACTAGATATGAGTGACAGCAACCTTCGGAAGCTATGGGAAGGAACTAAACAACTTAGAAATCTCAAGTGGATGGATTTGAGTGATTCTAGTTATCTGAAAGAGCTTCCCAATCTTTCAACTGCAACTAATCTCGAAGAATTAAAGCTTAGAAATTGCTCAAGTTTAGTGGAGCTCCCCTCCTCTATTGAAAAACTGACCAGTCTCCAAATATTAGATCTCCACAGTTGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGAATACAACTAAACTTAAGAAACTAGATCTTGGAAAGTGTTCGAGTCTTGTGAAGCTCCCACCATCTATCAATGCCAATAATCTTCAGGAATTGTCTCTAAGAAATTGTTCACGTGTTGTGAAGCTCCCCGCTATCGAGAATGCGACTAAGCTCCGTGAATTGAAGCTCCGAAATTGCTCAAGTCTAATAGAGCTCCCTCTTTCTATTGGAACTGCCACAAATCTGAAGAAACTGAATATAAGCGGATGCTCAAGTCTCGTGAAACTCCCATCCTCTATTGGAGATATGACAAATCTCGAAGTGTTTGATCTAGATAACTGCTCAAGTCTGGTGACGCTTCCTTCCTCGATAGGAAACCTTCAAAAATTGTCTGAGTTGTTAATGAGCGAATGCTCAAAGCTAGAGGCTCTTCCAACCAACATCAACTTGAAATCTCTCTATACACTTGATCTCACAGATTGCACGCAGTTGAAAAGTTTTCCCGAGATCTCCACACACATTTCAGAGCTCAGGTTAAAAGGAACTGCAATAAAAGAAGTTCCTTTGTCGATCACGTCGTGGTCTCGTCTTGCTGTATATGAAATGTCATACTTTGAAAGCCTTAAGGAATTCCCGCATGCTCTTGACATCATCACCGACCTACTTTTGGTAAGTGAAGATATACAAGAAGTTCCTCCATGGGTCAAGAGAATGTCTCGTTTACGTGATCTTAGACTCAACAACTGCAATAATCTGGTATCACTCCCCCAACTTTCAGATTCCCTTGATAATTATGCGATGTTACCCGGTACACAAGTGCCTGCCTGCTTCAATTACCGAGCTACTTCTGGGGATTCCTTGAAAATCAAGTTGAAGGAGTCGTCTCTTCCTAGAACCTTGAGATTTAAGGCTTGTATCATGCTTGTTAAGGCTTATGATTGGATATCGATGGGCGTTGGTATTGTCATCAGGGTCAAACAGAATGATCTCAAAGTTCTATGTACACCAAGCGGCTGTTATATATATCCAGTTTTAACAGAGCATATATATACATTTGAACTTGAAGTAGAGGAGGTGACTTCCACGGAGCTTGTCTTTGAGTTCACATTAGACAACGAAAGCAATTGGAAGATAGGAGAATGCGGGATTCTCCAAATCGTGGAGGTCCCTTGA


Protein sequences

Name Description Sequence
disease resistance protein RPP1-like protein R2 disease resistance protein RPP1-like protein R2 [Arabidopsis thaliana].

MGSAMSLSCSKRKATSQDVDSESCKRRKTCSTNDAENCIFIPDESSWSLCANRVISVAAVALTKFRFQQDNQESNSSSLSLPSPATSVSRNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELTEIMKCREVLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGYHSHSWRNEADMIEKIATYVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRHDLDEVRMIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRLCLDERSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTKVKELLGKFLDARQGLHILAQKSLISFDGERIHMHTLLEQFGRETSRKQFVYHGYTKHQLLVGERDICEVLNDDTTDSRRFIGINLDLYKNEEELNISEKALERIHDFQFVKINDVFTHQPERVQLALEDLIYQSPRIRSLKWFPYQNICLPSTFNPEFLVELDMSDSNLRKLWEGTKQLRNLKWMDLSDSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNTTKLKKLDLGKCSSLVKLPPSINANNLQELSLRNCSRVVKLPAIENATKLRELKLRNCSSLIELPLSIGTATNLKKLNISGCSSLVKLPSSIGDMTNLEVFDLDNCSSLVTLPSSIGNLQKLSELLMSECSKLEALPTNINLKSLYTLDLTDCTQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRDLRLNNCNNLVSLPQLSDSLDNYAMLPGTQVPACFNYRATSGDSLKIKLKESSLPRTLRFKACIMLVKAYDWISMGVGIVIRVKQNDLKVLCTPSGCYIYPVLTEHIYTFELEVEEVTSTELVFEFTLDNESNWKIGECGILQIVEVP

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
90-228 G3DSA:3.40.50.10140

RNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELTEIMKCREVLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVA

ProfileScan: PS50104
IPR000157
92-230 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELTEIMKCREVLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATI

HMMSmart: SM00255
IPR000157
93-230 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELTEIMKCREVLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATI

HMMPfam: PF01582
IPR000157
96-225 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELTEIMKCREVLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALE

HMMPanther: PTHR23155:SF296
104-1035 PTHR23155:SF296

DVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELTEIMKCREVLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGYHSHSWRNEADMIEKIATYVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRHDLDEVRMIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRLCLDERSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTKVKELLGKFLDARQGLHILAQKSLISFDGERIHMHTLLEQFGRETSRKQFVYHGYTKHQLLVGERDICEVLNDDTTDSRRFIGINLDLYKNEEELNISEKALERIHDFQFVKINDVFTHQPERVQLALEDLIYQSPRIRSLKWFPYQNICLPSTFNPEFLVELDMSDSNLRKLWEGTKQLRNLKWMDLSDSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNTTKLKKLDLGKCSSLVKLPPSINANNLQELSLRNCSRVVKLPAIENATKLRELKLRNCSSLIELPLSIGTATNLKKLNISGCSSLVKLPSSIGDMTNLEVFDLDNCSSLVTLPSSIGNLQKLSELLMSECSKLEALPTNINLKSLYTLDLTDCTQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRDLRLNNCNNLVSLPQLSDSLD

HMMPanther: PTHR23155
104-1035 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELTEIMKCREVLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGYHSHSWRNEADMIEKIATYVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRHDLDEVRMIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRLCLDERSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTKVKELLGKFLDARQGLHILAQKSLISFDGERIHMHTLLEQFGRETSRKQFVYHGYTKHQLLVGERDICEVLNDDTTDSRRFIGINLDLYKNEEELNISEKALERIHDFQFVKINDVFTHQPERVQLALEDLIYQSPRIRSLKWFPYQNICLPSTFNPEFLVELDMSDSNLRKLWEGTKQLRNLKWMDLSDSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNTTKLKKLDLGKCSSLVKLPPSINANNLQELSLRNCSRVVKLPAIENATKLRELKLRNCSSLIELPLSIGTATNLKKLNISGCSSLVKLPSSIGDMTNLEVFDLDNCSSLVTLPSSIGNLQKLSELLMSECSKLEALPTNINLKSLYTLDLTDCTQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRDLRLNNCNNLVSLPQLSDSLD

superfamily: SSF52540
147-519 SSF52540

SKIAIVLLSRKYASSSWCLDELTEIMKCREVLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGYHSHSWRNEADMIEKIATYVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRHDLDEVRMIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRLCLDERSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFL

Gene3D: G3DSA:3.40.50.300
255-415 G3DSA:3.40.50.300

MLNSFTPSRDFDGLVGMRAHMDMLEQLLRHDLDEVRMIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRLCLDERSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLK

HMMPfam: PF00931
IPR002182
276-532 NB-ARC,NBS
NB-ARC

DMLEQLLRHDLDEVRMIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRLCLDERSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTK

HMMSmart: SM00382
IPR003593
288-428 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRLCLDERSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYP

FPrintScan: PR00364
IPR000767
291-306 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
369-383 DISEASERSIST
Disease resistance protein

RLRDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
462-476 DISEASERSIST
Disease resistance protein

AGELPLGLKVLGSAL

superfamily: SSF46785
497-603 SSF46785

GNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTKVKELLGKFLDARQGLHILAQKSLISFDGERIHMHTLLEQFGRETSRKQFVYHGYTKHQLLVGERDICEVLN

Gene3D: G3DSA:3.80.10.10
622-855 G3DSA:3.80.10.10

NEEELNISEKALERIHDFQFVKINDVFTHQPERVQLALEDLIYQSPRIRSLKWFPYQNICLPSTFNPEFLVELDMSDSNLRKLWEGTKQLRNLKWMDLSDSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNTTKLKKLDLGKCSSLVKLPPSINANNLQELSLRNCSRVVKLPAIENATKLRELKLRNCSSLIELPLSIGTATNLK

superfamily: SSF52058
627-845 SSF52058,LRR

NISEKALERIHDFQFVKINDVFTHQPERVQLALEDLIYQSPRIRSLKWFPYQNICLPSTFNPEFLVELDMSDSNLRKLWEGTKQLRNLKWMDLSDSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNTTKLKKLDLGKCSSLVKLPPSINANNLQELSLRNCSRVVKLPAIENATKLRELKLRNCSSLIELP

HMMPfam: PF07725
IPR011713
690-709 LRR_3
Leucine-rich repeat 3

FLVELDMSDSNLRKLWEGTK

HMMPfam: PF00560
IPR001611
736-758 LRR_1
Leucine-rich repeat

NLEELKLRNCSSLVELPSSIEKL

FPrintScan: PR00364
IPR000767
756-772 DISEASERSIST
Disease resistance protein

EKLTSLQILDLHSCSSL

HMMPfam: PF00560
IPR001611
760-780 LRR_1
Leucine-rich repeat

SLQILDLHSCSSLVELPSFGN

superfamily: SSF52047
804-1022 SSF52047,LRR

ANNLQELSLRNCSRVVKLPAIENATKLRELKLRNCSSLIELPLSIGTATNLKKLNISGCSSLVKLPSSIGDMTNLEVFDLDNCSSLVTLPSSIGNLQKLSELLMSECSKLEALPTNINLKSLYTLDLTDCTQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRDLRLNNCN

HMMPfam: PF00560
IPR001611
806-825 LRR_1
Leucine-rich repeat

NLQELSLRNCSRVVKLPAIE

HMMPfam: PF13504
828-845 LRR_7,Leucine rich repeat

TKLRELKLRNCSSLIELP

HMMPfam: PF00560
IPR001611
853-873 LRR_1
Leucine-rich repeat

NLKKLNISGCSSLVKLPSSIG

Gene3D: G3DSA:3.80.10.10
856-1036 G3DSA:3.80.10.10

KLNISGCSSLVKLPSSIGDMTNLEVFDLDNCSSLVTLPSSIGNLQKLSELLMSECSKLEALPTNINLKSLYTLDLTDCTQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRDLRLNNCNNLVSLPQLSDSLDN

HMMPfam: PF00560
IPR001611
877-899 LRR_1
Leucine-rich repeat

NLEVFDLDNCSSLVTLPSSIGNL

HMMPfam: PF13504
1011-1028 LRR_7,Leucine rich repeat

SRLRDLRLNNCNNLVSLP


List of References

Rubén Alcázar, Ana V García, Jane E Parker, Matthieu Reymond
Incremental steps toward incompatibility revealed by Arabidopsis epistatic interactions modulating salicylic acid pathway activation.
Proc. Natl. Acad. Sci. U.S.A.: 2009, 106(1);334-9
PubMed:19106299 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox