PRGDB00047617 (putative NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 207339959 (FJ174201)
Gene Class TNL
Domain Type TIR, LRR, NBS
Gene Species Arabidopsis lyrata

Comment?

Arabidopsis lyrata isolate R16 putative NBS-LRR disease resistance protein gene, exon 1 and partial cds.

DNA Sequence

ACGGTACGGTACTCTTTTGTCAGCCACCTCTCCGCCGCTTACCACCGCAGAGGAGTATCTTCGTTCACCGGAGAACACGGCTCCGATTCGGAAACCAATGGATTCTCCAAGTTGGAGAAGTCTAGGGCTTCTGTAGTCGTTTTCTCTGAGAAATACCCGTCATCTAAGTCATGCATGGAGGAGCTGCTCAAGGTTTCCGAACACCAGAGAAAAAATTGTCTCGCGGTGGTTCCGGTGTTTTACCCAGTCACGAAATCGTTTGTGAAGAAACAAATCTGCAATTTGGCCGATGTTAGAAGC


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein putative NBS-LRR disease resistance protein [Arabidopsis lyrata].

TVRYSFVSHLSAAYHRRGVSSFTGEHGSDSETNGFSKLEKSRASVVVFSEKYPSSKSCMEELLKVSEHQRKNCLAVVPVFYPVTKSFVKKQICNLADVRS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF285
1-100 PTHR23155:SF285,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

TVRYSFVSHLSAAYHRRGVSSFTGEHGSDSETNGFSKLEKSRASVVVFSEKYPSSKSCMEELLKVSEHQRKNCLAVVPVFYPVTKSFVKKQICNLADVRS

HMMPanther: PTHR23155
1-100 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TVRYSFVSHLSAAYHRRGVSSFTGEHGSDSETNGFSKLEKSRASVVVFSEKYPSSKSCMEELLKVSEHQRKNCLAVVPVFYPVTKSFVKKQICNLADVRS

HMMPfam: PF01582
IPR000157
3-96 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYSFVSHLSAAYHRRGVSSFTGEHGSDSETNGFSKLEKSRASVVVFSEKYPSSKSCMEELLKVSEHQRKNCLAVVPVFYPVTKSFVKKQICNLA

superfamily: SSF52200
IPR000157
3-99 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYSFVSHLSAAYHRRGVSSFTGEHGSDSETNGFSKLEKSRASVVVFSEKYPSSKSCMEELLKVSEHQRKNCLAVVPVFYPVTKSFVKKQICNLADVR

Gene3D: G3DSA:3.40.50.10140
27-95 G3DSA:3.40.50.10140

GSDSETNGFSKLEKSRASVVVFSEKYPSSKSCMEELLKVSEHQRKNCLAVVPVFYPVTKSFVKKQICNL

ProfileScan: PS50104
IPR000157
38-100 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LEKSRASVVVFSEKYPSSKSCMEELLKVSEHQRKNCLAVVPVFYPVTKSFVKKQICNLADVRS


List of References

Gesseca Gos, Stephen I Wright
Conditional neutrality at two adjacent NBS-LRR disease resistance loci in natural populations of Arabidopsis lyrata.
Mol. Ecol.: 2008, 17(23);4953-62
PubMed:18992006 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox