PRGDB00047898 (nucleotide binding site leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
nucleotide binding site leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 209981217 (EU939872)
Gene Class N
Domain Type NBS
Gene Species Pyrus betulifolia

Comment?

Pyrus betulifolia clone Pbtf4 nucleotide binding site leucine-rich repeat disease resistance protein gene, partial cds.

DNA Sequence

TACTCGATGATGTCTGGAGCGAAGATTATGAGCCTTGGCAAAACTTGATGACTCACTTCAATAGTTGCGGAGTACGCGGAAGTAAGATCATTGTCACAACACGCCAAAGACGCGTTGCATCTATCACCGGGACTCTTTCAACACATGATCTACAGGGAATATCCGAGGACGATTCTTGGTTGTTATTTGCAAAGCATGCCTTCAAGGAAGACAGTGTTATTACTGCCCATCCGGATCTTGAAGTCATTGGAAGGAAAATTGTTAAGAAGTGTCAAGGCCTTCCTTTAGCCCTCA


Protein sequences

Name Description Sequence
nucleotide binding site leucine-rich repeat disease resistance protein nucleotide binding site leucine-rich repeat disease resistance protein [Pyrus betulifolia].

LDDVWSEDYEPWQNLMTHFNSCGVRGSKIIVTTRQRRVASITGTLSTHDLQGISEDDSWLLFAKHAFKEDSVITAHPDLEVIGRKIVKKCQGLPLAL


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-97 SSF52540

LDDVWSEDYEPWQNLMTHFNSCGVRGSKIIVTTRQRRVASITGTLSTHDLQGISEDDSWLLFAKHAFKEDSVITAHPDLEVIGRKIVKKCQGLPLAL

HMMPfam: PF00931
IPR002182
1-97 NB-ARC,NBS
NB-ARC

LDDVWSEDYEPWQNLMTHFNSCGVRGSKIIVTTRQRRVASITGTLSTHDLQGISEDDSWLLFAKHAFKEDSVITAHPDLEVIGRKIVKKCQGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox