PRGDB00047908 (nucleotide binding site leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
nucleotide binding site leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 209981197 (EU939862)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Pyrus hybrid cultivar

Comment?

Pyrus hybrid cultivar clone Ph-Hg-3 nucleotide binding site leucine-rich repeat disease resistance protein gene, partial cds.

DNA Sequence

GGTGTTGGTAAGACTACAATTGCAAAAGCTGTTTATAATGCAATTGCTCATAAGTTTGAAGGTAGTTGTTTCCTGGCAGATGTGAGAGAAACATCGACATCACATGAAGGTGTAATCAAACTACAAAGCACTCTTCTATCTAAAGTTCTACGCGGTACAGAGTTGAAAATTGACGATGTTCATCACGGAATCAGCCTTATAGAGAAATTGTTGAGGCGAAAGAAGATTCTCTTAATTCTTGATGATGTGGATGAATTGGGGCAGTTAAACAACTTGGTTGAAGTCGATTGGTTTGGTGAGGGTAGCAGAGTGATCATAACCACAAAAGATAGAGGATTGTTAGAATCTTATGGAGTCAAGTTGATATACAAGGTCCAAAAGTTAGAATATGACAAAGCTCTTGAGCTTTTAAGTTTGAATGCCTTCACAAGAAAAGAACCTTCACTCGATTATTTGAGCCTCGCACGACGTGCAATAGCCTATGCTCAAGGCCTTCCTTTAGCCCTC


Protein sequences

Name Description Sequence
nucleotide binding site leucine-rich repeat disease resistance protein nucleotide binding site leucine-rich repeat disease resistance protein [Pyrus hybrid cultivar].

GVGKTTIAKAVYNAIAHKFEGSCFLADVRETSTSHEGVIKLQSTLLSKVLRGTELKIDDVHHGISLIEKLLRRKKILLILDDVDELGQLNNLVEVDWFGEGSRVIITTKDRGLLESYGVKLIYKVQKLEYDKALELLSLNAFTRKEPSLDYLSLARRAIAYAQGLPLAL

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
1-117 G3DSA:3.40.50.300

GVGKTTIAKAVYNAIAHKFEGSCFLADVRETSTSHEGVIKLQSTLLSKVLRGTELKIDDVHHGISLIEKLLRRKKILLILDDVDELGQLNNLVEVDWFGEGSRVIITTKDRGLLESY

HMMPanther: PTHR11017
1-169 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVGKTTIAKAVYNAIAHKFEGSCFLADVRETSTSHEGVIKLQSTLLSKVLRGTELKIDDVHHGISLIEKLLRRKKILLILDDVDELGQLNNLVEVDWFGEGSRVIITTKDRGLLESYGVKLIYKVQKLEYDKALELLSLNAFTRKEPSLDYLSLARRAIAYAQGLPLAL

superfamily: SSF52540
1-169 SSF52540

GVGKTTIAKAVYNAIAHKFEGSCFLADVRETSTSHEGVIKLQSTLLSKVLRGTELKIDDVHHGISLIEKLLRRKKILLILDDVDELGQLNNLVEVDWFGEGSRVIITTKDRGLLESYGVKLIYKVQKLEYDKALELLSLNAFTRKEPSLDYLSLARRAIAYAQGLPLAL

HMMPfam: PF00931
IPR002182
1-169 NB-ARC,NBS
NB-ARC

GVGKTTIAKAVYNAIAHKFEGSCFLADVRETSTSHEGVIKLQSTLLSKVLRGTELKIDDVHHGISLIEKLLRRKKILLILDDVDELGQLNNLVEVDWFGEGSRVIITTKDRGLLESYGVKLIYKVQKLEYDKALELLSLNAFTRKEPSLDYLSLARRAIAYAQGLPLAL

HMMPanther: PTHR11017:SF20
1-169 PTHR11017:SF20,SUBFAMILY NOT NAMED

GVGKTTIAKAVYNAIAHKFEGSCFLADVRETSTSHEGVIKLQSTLLSKVLRGTELKIDDVHHGISLIEKLLRRKKILLILDDVDELGQLNNLVEVDWFGEGSRVIITTKDRGLLESYGVKLIYKVQKLEYDKALELLSLNAFTRKEPSLDYLSLARRAIAYAQGLPLAL

FPrintScan: PR00364
IPR000767
70-84 DISEASERSIST
Disease resistance protein

LLRRKKILLILDDVD

FPrintScan: PR00364
IPR000767
162-169 DISEASERSIST
Disease resistance protein

AQGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox