PRGDB00047909 (nucleotide binding site leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
nucleotide binding site leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 209981195 (EU939861)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Pyrus hybrid cultivar

Comment?

Pyrus hybrid cultivar clone Ph-Hg-2 nucleotide binding site leucine-rich repeat disease resistance protein gene, partial cds.

DNA Sequence

GGATCTGGTAAAACAACTGCTGCCAACGCTATTTATGACAAAATTCATCATCGCTTCCAGTTTAAATGTTACCTTGGCGATGTTAGCGACACTGAACATAGATATGGTTTGGAATGGTTGCAAAACCAACTTGTTTCTAACATTTCGAAACAAACCACCCCGATAAATAGTGTCGGTGAAGGGATCGGTGTAATAAAACGATATCTTCAATGTCGAAAAGTACTTATTGTTATTGATAATGTAGATAAAGTGGAGCAACTAAGTGCACTAGCTGATGATCGTGAGTGGTTTGGTCCAGGAAGTATAATTATCATAACAACAAGAGATGAGCATTTACTAAAACAAGCGGGAGTGAAAGTGAGATATGCAGCTGAGGAAATGAATGAAGAGGAGGCTCTTGAGCTTTTCAGTTGGTATACATTTAAAAATAATTGCCCTAAGGGAGAATATCTTGAATTGTCAAGGAAGGTAGTTTCTTACTGTGGAGGTTTACCCTTAGCACT


Protein sequences

Name Description Sequence
nucleotide binding site leucine-rich repeat disease resistance protein nucleotide binding site leucine-rich repeat disease resistance protein [Pyrus hybrid cultivar].

GSGKTTAANAIYDKIHHRFQFKCYLGDVSDTEHRYGLEWLQNQLVSNISKQTTPINSVGEGIGVIKRYLQCRKVLIVIDNVDKVEQLSALADDREWFGPGSIIIITTRDEHLLKQAGVKVRYAAEEMNEEEALELFSWYTFKNNCPKGEYLELSRKVVSYCGGLPLAL

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-168 NB-ARC,NBS
NB-ARC

GSGKTTAANAIYDKIHHRFQFKCYLGDVSDTEHRYGLEWLQNQLVSNISKQTTPINSVGEGIGVIKRYLQCRKVLIVIDNVDKVEQLSALADDREWFGPGSIIIITTRDEHLLKQAGVKVRYAAEEMNEEEALELFSWYTFKNNCPKGEYLELSRKVVSYCGGLPLAL

superfamily: SSF52540
1-168 P-loop containing nucleoside triphosphate hydrolases

GSGKTTAANAIYDKIHHRFQFKCYLGDVSDTEHRYGLEWLQNQLVSNISKQTTPINSVGEGIGVIKRYLQCRKVLIVIDNVDKVEQLSALADDREWFGPGSIIIITTRDEHLLKQAGVKVRYAAEEMNEEEALELFSWYTFKNNCPKGEYLELSRKVVSYCGGLPLAL

Gene3D: G3DSA:3.40.50.300
1-115 no description

GSGKTTAANAIYDKIHHRFQFKCYLGDVSDTEHRYGLEWLQNQLVSNISKQTTPINSVGEGIGVIKRYLQCRKVLIVIDNVDKVEQLSALADDREWFGPGSIIIITTRDEHLLKQ

HMMPanther: PTHR11017
3-168 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKTTAANAIYDKIHHRFQFKCYLGDVSDTEHRYGLEWLQNQLVSNISKQTTPINSVGEGIGVIKRYLQCRKVLIVIDNVDKVEQLSALADDREWFGPGSIIIITTRDEHLLKQAGVKVRYAAEEMNEEEALELFSWYTFKNNCPKGEYLELSRKVVSYCGGLPLAL

HMMPanther: PTHR11017:SF20
3-168 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GKTTAANAIYDKIHHRFQFKCYLGDVSDTEHRYGLEWLQNQLVSNISKQTTPINSVGEGIGVIKRYLQCRKVLIVIDNVDKVEQLSALADDREWFGPGSIIIITTRDEHLLKQAGVKVRYAAEEMNEEEALELFSWYTFKNNCPKGEYLELSRKVVSYCGGLPLAL

FPrintScan: PR00364
IPR000767
68-82 DISEASERSIST
Disease resistance protein

YLQCRKVLIVIDNVD

Seg: seg
123-135 seg

AAEEMNEEEALEL

FPrintScan: PR00364
IPR000767
161-168 DISEASERSIST
Disease resistance protein

CGGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox