PRGDB00047950 (nucleotide binding site leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
nucleotide binding site leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 209981113 (EU939820)
Gene Class NL
Domain Type NBS, LRR
Gene Species Pyrus pyrifolia

Comment?

Pyrus pyrifolia clone Pp-Qh-5 nucleotide binding site leucine-rich repeat disease resistance protein gene, partial cds.

DNA Sequence

GGATCTGGTAAAACAACATCTGCGAAAGCCATTTCTAACAAAATTCATCATAAGTTCCAGTTCAAATGTATCCTTGCCGACGTTCGCGACAATACAAGTAAACATGGTCTGGCTTATTTGCAAGAAAAACTTATTTTTGACATCTCGAAACAGAAGTCTGAAATAAGCAGTGTTGATAAAGGTATCAGTCTGATAGAAGATCAATTTTCACATAGAAAGGTACTTGTCATCATAGACAACATAGATGAAGTGGAACAACTGAATGCAATAGCTGGAAATCACAAATGGTTTGGTCCTGGAAGTAGAATTATCATAACGACACGAGATGAACATTTACTAAAGCAAGGGAAAGTGAACAAGACATATCCGGCTCAGGAATTGAATAAAGAAGAAGCTCTAGAGCTCTTGAGTTGGCATGCCTTTGGAAATCGACAGCCTAGCGAAGGATTTCTTGAACTCTCAGAAAAGTTTGTTTCTTACTGTGATGGTTTACCATTAGCCCT


Protein sequences

Name Description Sequence
nucleotide binding site leucine-rich repeat disease resistance protein nucleotide binding site leucine-rich repeat disease resistance protein [Pyrus pyrifolia].

GSGKTTSAKAISNKIHHKFQFKCILADVRDNTSKHGLAYLQEKLIFDISKQKSEISSVDKGISLIEDQFSHRKVLVIIDNIDEVEQLNAIAGNHKWFGPGSRIIITTRDEHLLKQGKVNKTYPAQELNKEEALELLSWHAFGNRQPSEGFLELSEKFVSYCDGLPLAL


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-168 SSF52540

GSGKTTSAKAISNKIHHKFQFKCILADVRDNTSKHGLAYLQEKLIFDISKQKSEISSVDKGISLIEDQFSHRKVLVIIDNIDEVEQLNAIAGNHKWFGPGSRIIITTRDEHLLKQGKVNKTYPAQELNKEEALELLSWHAFGNRQPSEGFLELSEKFVSYCDGLPLAL

HMMPfam: PF00931
IPR002182
1-168 NB-ARC,NBS
NB-ARC

GSGKTTSAKAISNKIHHKFQFKCILADVRDNTSKHGLAYLQEKLIFDISKQKSEISSVDKGISLIEDQFSHRKVLVIIDNIDEVEQLNAIAGNHKWFGPGSRIIITTRDEHLLKQGKVNKTYPAQELNKEEALELLSWHAFGNRQPSEGFLELSEKFVSYCDGLPLAL

Gene3D: G3DSA:3.40.50.300
1-115 G3DSA:3.40.50.300

GSGKTTSAKAISNKIHHKFQFKCILADVRDNTSKHGLAYLQEKLIFDISKQKSEISSVDKGISLIEDQFSHRKVLVIIDNIDEVEQLNAIAGNHKWFGPGSRIIITTRDEHLLKQ

HMMPanther: PTHR11017
3-168 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKTTSAKAISNKIHHKFQFKCILADVRDNTSKHGLAYLQEKLIFDISKQKSEISSVDKGISLIEDQFSHRKVLVIIDNIDEVEQLNAIAGNHKWFGPGSRIIITTRDEHLLKQGKVNKTYPAQELNKEEALELLSWHAFGNRQPSEGFLELSEKFVSYCDGLPLAL

HMMPanther: PTHR11017:SF20
3-168 PTHR11017:SF20,SUBFAMILY NOT NAMED

GKTTSAKAISNKIHHKFQFKCILADVRDNTSKHGLAYLQEKLIFDISKQKSEISSVDKGISLIEDQFSHRKVLVIIDNIDEVEQLNAIAGNHKWFGPGSRIIITTRDEHLLKQGKVNKTYPAQELNKEEALELLSWHAFGNRQPSEGFLELSEKFVSYCDGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox