PRGDB00047952 (nucleotide binding site leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
nucleotide binding site leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 209981109 (EU939818)
Gene Class TNL
Domain Type NBS, LRR, TIR, Others
Gene Species Pyrus pyrifolia

Comment?

Pyrus pyrifolia clone Pp-Qh-3 nucleotide binding site leucine-rich repeat disease resistance protein gene, partial cds.

DNA Sequence

GGATCCGGTAAAACAACAATTGCTAAAGCCATTTATAACCAATTTTGTGACAAGTTTGAAGGTAAGAGTTTCCTTGAAAACATGAGGGGAAAGAACCTAGTTAACTTGCAAAACCAACTTCTTTCTGATATCTTGCAAACTAAGACAAAAGTAAGCAGTATTGCCAAAGGGACCGCCTTGGTAGGGAAAAGATTTCGATGCTTAAGAGTACTTGTCATCTTGGATGATGTAGATGATTTGAAGCAACTAGACGAATTAGTTGTAAATCGCCACTCTTTTGGTCTGGGGAGCAGAATTATCATAACAACAAGAAATGAACATGTGTTAAATGAATTTGCAGTTGATGTGATATATCGGTCACAAGGAATGGAACGAGAAGAAGCTCTTGAGCTTTTTAGTTGGCATGCTTTCAGAAGTAGTTGTTGTCCTAGAAAATATCTGAACCTCGCAAGAGAAGTTGTCGATTACTGTGGAGGTTTGCCCTTAGCCCT


Protein sequences

Name Description Sequence
nucleotide binding site leucine-rich repeat disease resistance protein nucleotide binding site leucine-rich repeat disease resistance protein [Pyrus pyrifolia].

GSGKTTIAKAIYNQFCDKFEGKSFLENMRGKNLVNLQNQLLSDILQTKTKVSSIAKGTALVGKRFRCLRVLVILDDVDDLKQLDELVVNRHSFGLGSRIIITTRNEHVLNEFAVDVIYRSQGMEREEALELFSWHAFRSSCCPRKYLNLAREVVDYCGGLPLAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF130
1-164 PTHR11017:SF130,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

GSGKTTIAKAIYNQFCDKFEGKSFLENMRGKNLVNLQNQLLSDILQTKTKVSSIAKGTALVGKRFRCLRVLVILDDVDDLKQLDELVVNRHSFGLGSRIIITTRNEHVLNEFAVDVIYRSQGMEREEALELFSWHAFRSSCCPRKYLNLAREVVDYCGGLPLAL

HMMPanther: PTHR11017
1-164 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GSGKTTIAKAIYNQFCDKFEGKSFLENMRGKNLVNLQNQLLSDILQTKTKVSSIAKGTALVGKRFRCLRVLVILDDVDDLKQLDELVVNRHSFGLGSRIIITTRNEHVLNEFAVDVIYRSQGMEREEALELFSWHAFRSSCCPRKYLNLAREVVDYCGGLPLAL

HMMPfam: PF00931
IPR002182
1-164 NB-ARC,NBS
NB-ARC

GSGKTTIAKAIYNQFCDKFEGKSFLENMRGKNLVNLQNQLLSDILQTKTKVSSIAKGTALVGKRFRCLRVLVILDDVDDLKQLDELVVNRHSFGLGSRIIITTRNEHVLNEFAVDVIYRSQGMEREEALELFSWHAFRSSCCPRKYLNLAREVVDYCGGLPLAL

Gene3D: G3DSA:3.40.50.300
1-106 G3DSA:3.40.50.300

GSGKTTIAKAIYNQFCDKFEGKSFLENMRGKNLVNLQNQLLSDILQTKTKVSSIAKGTALVGKRFRCLRVLVILDDVDDLKQLDELVVNRHSFGLGSRIIITTRNE

superfamily: SSF52540
1-164 SSF52540

GSGKTTIAKAIYNQFCDKFEGKSFLENMRGKNLVNLQNQLLSDILQTKTKVSSIAKGTALVGKRFRCLRVLVILDDVDDLKQLDELVVNRHSFGLGSRIIITTRNEHVLNEFAVDVIYRSQGMEREEALELFSWHAFRSSCCPRKYLNLAREVVDYCGGLPLAL

FPrintScan: PR00364
IPR000767
64-78 DISEASERSIST
Disease resistance protein

RFRCLRVLVILDDVD

FPrintScan: PR00364
IPR000767
157-164 DISEASERSIST
Disease resistance protein

CGGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox