PRGDB00047998 (AT4g12370)

From PRG Wiki
Jump to: navigation, search
AT4g12370
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7267889 (AL161533)
Gene Class TNL
Domain Type LRR, LRR, NBS, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 33.

DNA Sequence

ATGTCGGAGAAGGAAGAACTTCCGTTGACATTGACGTCCATCGGAGCGGCCACCGCGACTAGTGATTATCATCAGAGAGTAGGAAGTTCCGGTGAAGGGATTAGTAGCTCGAGTAGTGATGTTGACCCGAGGTTCATGCAGAATAGCCCCACGGGTTTGATGATTTCCCAATCGTCGTCGATGTGCACCGTACCGCCTGGCATGGCAGCAACACCACCAATAAGCTCAGGTTCCGGTTTATCTCAGCAGCTTAATAATTCTTCTAGTTCCAAGTTATGTCAAGTGGAAGGATGTCAAAAAGGAGCAAGAGATGCATCTGGTCGTTGCATTTCCCATGGCGGTGGACGTAGATGCCAGAAACCTGATTGCCAGAAGGGAGCTGAAGGTAAAACAGTGTACTGTAAAGCCCACGGAGGTGGTCGCAGATGTGAATATCTTGGATGCACCAAAGGCGCAGAAGGCAGTACTGATTTTTGTATAGCTCATGGAGGTGGTCGAAGATGCAACCATGAAGATTGCACACGATCTGCTTGGGGAAGAACAGAATTCTGTGTCAAGCACGGTGGAGGAGCGAGATGCAAAACATACGGCTGCGGAAAAAGCGCTAGTGGTCCTTTGCCATTCTGCCGAGCCCATGGTGGTGGTAAAAAATGCAGCCATGAAGATTGCACAGGATTTGCTAGGGGAAGATCAGGACTCTGTCTCATGCACGGTGGGGGAAAGAGATGCCAAAGAGAGAACTGCACTAAAAGCGCTGAAGGTCTTTCGGGACTCTGCATATCCCATGGTGGTGGTCGGCGATGTCAATCTATTGGATGCACAAAAGGAGCGAAAGGGAGCAAAATGTTCTGCAAAGCATGCATAACTAAAAGGCCTCTAACGATTGATGGAGGAGGAAATATGGGAGGGGTAACAACAGGTGATGCCTTGAACTATCTCAAAGCTGTGAAGGACAAGTTTGAAGACAGTGAGAAATATGACACTTTCCTTGAAGTCTTGAATGACTGTAAACATCAGGGAGTTGACACTAGTGGCGTCATAGCCAGATTAAAAGATTTGTTCAAGGGCCATGACGACTTACTTTTGGGTTTTAATACCTACTTGTCAAAGGAGTACCAAATAACCATTCTGCCCGAGGATGATTTCCCTATCGATTTTCTTGACAAGGTTGAGGGACCTTATGAAATGACATATCAGCAAGCTCAAACAGTTCAAGCCAATGCCAATATGCAACCTCAAACTGAGTACCCTTCTTCCTCTGCGGTTCAATCATTTTCATCGGGTCAACCTCAGATCCCCACCTCAGCTCCGGATTCTTCACTACTAGCTAAAAGTAATACCTCAGGTATAACTATCATCGAGCACATGTCACAACAGCCTCTAAATGTTGACAAACAAGTTAATGATGGCTATAACTGGCAAAAGTATGGGCAAAAGAAAGTTAAAGGCAGCAAGTTTCCTCTAAGCTATTACAAGTGCACATATCTAGGATGTCCTTCCAAGAGGAAGGTTGAGAGATCTCTTGATGGACAAGTAGCAGAAATCGTCTACAAAGATCGACACAATCACGAACCTCCTAACCAAGGAAAAGATGGTAGCACCACATATCTAAGTGGGAGTTCGACACACATCAATTGCATGAGCTCTGAATTGACAGCATCACAGTTTAGCTCCAACAAGACTAAGATAGAGCAACAGGAAGCAGCAAGTCTAGCTACGACAATAGAGTACATGTCTGAGGCAAGTGACAATGAAGAAGACAGTAATGGAGAAACTAGTGAGGGAGAGAAAGATGAAGACGAGCCTGAACCAAAGAGAAGAATTACAGAAGTTCAGGTTTCGGAACTAGCTGATGCTTCAGATAGAACCGTGAGAGAGCCTAGGGTTATTTTCCAAACAACGAGTGAAGTTGATAATTTAGATGATGGATATAGGTGGCGGAAATATGGACAGAAAGTTGTTAAAGGGAATCCTTATCCAAGGTTTTCCTCCTCTAAAGATTATGATGTCGTAATCAGATACGGAAGAGCAGATATAAGCAATGAGGATTTCATTAGCCATCTTCGTGCTTCCCTCTGCCGGAGAGGGATTTCTGTCTATGAAAAATTTAATGAAGTGGATGCACTTCCAAAATGTAGGGTTTTGATTATAGTATTAACAAGCACATATGTCCCTTCGAACCTCTTAAACATTCTTGAACACCAACATACAGAGGATCGAGTGGTTTATCCAATTTTCTACAGACTATCACCATATGATTTTGTCTGTAACAGCAAGAATTATGAGAGATTTTATCTCCAAGATGAGCCAAAAAAATGGCAAGCTGCTTTGAAGGAAATAACTCAGATGCCTGGCTACACATTGACAGATAAGTCTGAATCTGAACTTATAGATGAGATTGTAAGAGATGCTTTAAAGGTGCTATGTTCTGCTGATAAGGTGAACATGATTGGGATGGATATGCAAGTAGAGGAGATTTTGTCACTGCTATGCATTGAGTCCCTTGATGTTCGCAGCATTGGTATATGGGGTACAGTTGGTATAGGAAAAACAACCATTGCTGAAGAGATCTTTCGCAAAATCTCTGTCCAATATGAGACCTGTGTCGTCCTTAAGGACCTCCACAAAGAAGTTGAGGTAAAAGGTCACGATGCTGTGAGAGAGAATTTTCTGTCTGAAGTTTTAGAGGTAGAACCTCATGTTATCCGGATATCTGACATTAAAACAAGCTTCTTGAGAAGTCGGCTTCAGCGTAAAAGGATCCTTGTTATTCTTGACGATGTGAATGATTACAGAGATGTTGACACCTTTTTGGGGACGCTTAACTATTTTGGTCCAGGAAGCAGAATAATCATGACCTCTAGAAATAGACGTGTTTTCGTACTATGTAAAATCGATCATGTCTATGAGGTTAAGCCATTAGATATTCCTAAGTCTCTACTACTTCTTGATCGTGGGACATGTCAAATTGTTTTGTCACCTGAGGTTTACAAGACATTGTCACTTGAGCTGGTCAAATTTTCAAATGGAAATCCCCAGGTTCTTCAGTTCTTGAGCAGTATTGACAGAGAATGGAATAAGTTATCACAAGAAGTTAAGACAACATCTCCCATTTACATCCCAGGTATATTTGAAAAGAGCTGTTGTGGGCTTGATGACAACGAGAGGGGTATATTTTTGGACATTGCATGTTTCTTTAATAGGATTGATAAAGACAATGTCGCAATGTTGCTGGATGGTTGTGGTTTCTCTGCACATGTCGGATTTAGAGGCCTTGTTGACAAATCACTGTTGACAATATCACAACACAACTTGGTGGACATGCTCAGTTTTATCCAGGCAACTGGTCGAGAAATTGTTCGCCAAGAATCAGCTGACAGACCAGGAGACCGCAGCAGGTTGTGGAATGCCGACTATATCAGACACGTATTCATAAATGACACTGGCACATCAGCTATTGAGGGCATTTTCCTAGACATGTTGAATCTTAAATTTGATGCAAATCCCAACGTGTTCGAGAAAATGTGTAACCTTAGACTGTTGAAATTGTATTGCTCCAAAGCGGAAGAGAAGCATGGAGTATCTTTTCCACAAGGTCTTGAATATTTGCCGAGCAAGCTAAGGCTTCTCCATTGGGAATATTATCCTCTAAGTTCTTTGCCGAAAAGTTTTAATCCAGAGAACCTTGTCGAGCTTAACTTGCCAAGTAGCTGTGCAAAGAAACTTTGGAAAGGAAAAAAGGCAAGGTTTTGTACAACCAATTCAAGTCTGGAAAAGCTTAAAAAGATGAGACTTAGCTACTCCGACCAGTTAACTAAAATCCCAAGACTTTCAAGCGCAACAAATCTTGAGCATATTGATCTTGAAGGTTGCAACAGTTTGTTGAGCCTTAGCCAGTCCATTTCTTATCTTAAGAAGCTTGTTTTTCTGAATTTAAAGGGCTGCTCGAAGCTGGAGAATATTCCATCTATGGTTGATTTAGAATCGCTTGAGGTTCTAAATCTTTCGGGTTGTTCAAAGCTAGGGAACTTCCCGGAGATCTCACCAAATGTGAAAGAACTGTACATGGGTGGGACTATGATACAAGAAATCCCGTCATCGATTAAGAACTTGGTATTGCTTGAGAAACTGGACCTGGAAAACAGTAGACATCTCAAGAATCTTCCAACAAGCATCTACAAGTTGAAGCATCTTGAAACTCTAAATCTTTCAGGCTGCATAAGCCTGGAGCGATTTCCAGACTCGTCGAGAAGGATGAAATGCTTAAGGTTTTTGGATTTAAGCAGGACAGACATTAAAGAGCTGCCCTCTTCCATATCGTATCTGACTGCTCTTGACGAACTATTATTCGTAGACTCCAGGAGAAACTCGCCAGTTGTAACCAATCCCAATGCCAATTCAACTGAGTTGATGCCTTCTGAGTCAAGTAAGCTTGAGATCTTAGGTACTCCGGCAGATAACGAAGTAGTTGTTGGTGGTACGGTAGAGAAAACCCGTGGTATTGAACGAACGCCGACTATTTTGGTGAAGTCGAGAGAGTATCTAATTCCCGATGATGTTGTGGCGGTTGGTGGTGATATTAAGGGGCTAAGACCACCAGTACTTCAGCTCCAACCAGCAATGAAACTATCTCATATTCCTCGAGGATCAACTTGGGATTTCGTTACGCATTTCGCTCCACCTGAAACAGTTGCGCCGCCGAGTTCCTCTTCAGAAGCCAGGGAAGAGGAAGTGGAAACGGAAGAGACGGGAGCTATGTTTATCCCATTGGGGGATAAGGAGACATGCTCATTCACTGTAAACAAGGGTGACTCCTCAAGGACAATATCTAATACGTCGCCGATTTATGCCTCCGAAGGATCTTTCATCACGTGTTGGCAGAAGGGTCAACTTCTGGGACGAGGATCATTAGGGTCCGTATATGAAGGCATTTCAGCAGACGGGGACTTCTTTGCTTTCAAGGAAGTTTCACTACTTGATCAGGGAAGTCAGGCACATGAATGGATACAACAAGTCGAGGGGGGGATTGCGCTACTTAGTCAGCTTCAGCATCAGAATATCGTGCGATATCGTGGCACAACTAAGGACGAGTCGAATTTGTACATTTTTCTTGAACTTGTAACCCAAGGGTCCCTTCGAAAACTCTACCAAAGAAACCAGCTTGGGGACTCTGTAGTCTCCTTATACACAAGACAGATTCTTGATGGATTGAAATATCTCCACGATAAAGGTTTTATACACAGGAACATTAAATGTGCAAATGTATTGGTGGACGCTAATGGAACAGTTAAACTTGCAGATTTTGGATTGGCTAAGGTAATGTCCCTCTGGCGAACTCCGTATTGGAATTGGATGGCTCCAGAGGTTATTCTTAACCCGAAGGATTATGATGGTTATGGAACTCCAGCTGATATATGGAGCCTTGGGTGTACTGTGCTAGAAATGTTGACTGGTCAGATTCCCTACTCCGATCTGGAAATCGGTACAGCCTTGTATAACATTGGAACGGGTAAGCTTCCGAAAATACCTGATATTCTATCGCTAGACGCCCGGGATTTCATACTTACGTGTCTCAAAGTGAACCCGGAAGAGCGGCCAACTGCAGCTGAGCTGCTTAACCATCCATTTGTGAATATGCCATTACCATCCTCGGGCTCAGGTTCAGTATCTTCGCTCCTCCGTGGATGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MSEKEELPLTLTSIGAATATSDYHQRVGSSGEGISSSSSDVDPRFMQNSPTGLMISQSSSMCTVPPGMAATPPISSGSGLSQQLNNSSSSKLCQVEGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGSTDFCIAHGGGRRCNHEDCTRSAWGRTEFCVKHGGGARCKTYGCGKSASGPLPFCRAHGGGKKCSHEDCTGFARGRSGLCLMHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSIGCTKGAKGSKMFCKACITKRPLTIDGGGNMGGVTTGDALNYLKAVKDKFEDSEKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYLSKEYQITILPEDDFPIDFLDKVEGPYEMTYQQAQTVQANANMQPQTEYPSSSAVQSFSSGQPQIPTSAPDSSLLAKSNTSGITIIEHMSQQPLNVDKQVNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEPPNQGKDGSTTYLSGSSTHINCMSSELTASQFSSNKTKIEQQEAASLATTIEYMSEASDNEEDSNGETSEGEKDEDEPEPKRRITEVQVSELADASDRTVREPRVIFQTTSEVDNLDDGYRWRKYGQKVVKGNPYPRFSSSKDYDVVIRYGRADISNEDFISHLRASLCRRGISVYEKFNEVDALPKCRVLIIVLTSTYVPSNLLNILEHQHTEDRVVYPIFYRLSPYDFVCNSKNYERFYLQDEPKKWQAALKEITQMPGYTLTDKSESELIDEIVRDALKVLCSADKVNMIGMDMQVEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDHVYEVKPLDIPKSLLLLDRGTCQIVLSPEVYKTLSLELVKFSNGNPQVLQFLSSIDREWNKLSQEVKTTSPIYIPGIFEKSCCGLDDNERGIFLDIACFFNRIDKDNVAMLLDGCGFSAHVGFRGLVDKSLLTISQHNLVDMLSFIQATGREIVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLKFDANPNVFEKMCNLRLLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDELLFVDSRRNSPVVTNPNANSTELMPSESSKLEILGTPADNEVVVGGTVEKTRGIERTPTILVKSREYLIPDDVVAVGGDIKGLRPPVLQLQPAMKLSHIPRGSTWDFVTHFAPPETVAPPSSSSEAREEEVETEETGAMFIPLGDKETCSFTVNKGDSSRTISNTSPIYASEGSFITCWQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVILNPKDYDGYGTPADIWSLGCTVLEMLTGQIPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEERPTAAELLNHPFVNMPLPSSGSGSVSSLLRG

Domains

Domain Start-End Description Sequence

Seg: seg
28-39 seg

GSSGEGISSSSS

Seg: seg
75-90 seg

SSGSGLSQQLNNSSSS

ProfileScan: PS51477
IPR003822
291-371 PAH,PAH domain profile.
Paired amphipathic helix

RPLTIDGGGNMGGVTTGDALNYLKAVKDKFEDSEKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYLSKE

Seg: seg
294-307 seg

TIDGGGNMGGVTTG

superfamily: SSF47762
IPR003822
297-371 PAH2 domain
Paired amphipathic helix

GGGNMGGVTTGDALNYLKAVKDKFEDSEKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYLSKE

Gene3D: G3DSA:1.20.1160.11
IPR003822
304-372 no description
Paired amphipathic helix

VTTGDALNYLKAVKDKFEDSEKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYLSKEY

HMMPfam: PF02671
IPR003822
324-368 PAH
Paired amphipathic helix

EKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYL

Seg: seg
418-427 seg

SSSAVQSFSS

superfamily: SSF118290
IPR003657
458-527 WRKY DNA-binding domain
DNA-binding WRKY

QQPLNVDKQVNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEPPN

ProfileScan: PS50811
IPR003657
462-526 WRKY
DNA-binding WRKY

NVDKQVNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEPP

Gene3D: G3DSA:2.20.25.80
IPR003657
462-526 no description
DNA-binding WRKY

NVDKQVNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEPP

HMMPfam: PF03106
IPR003657
467-524 WRKY
DNA-binding WRKY

VNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHE

HMMSmart: SM00774
IPR003657
467-525 DNA binding domain
DNA-binding WRKY

VNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEP

Seg: seg
590-607 seg

GETSEGEKDEDEPEPKRR

Gene3D: G3DSA:2.20.25.80
IPR003657
625-662 no description
DNA-binding WRKY

REPRVIFQTTSEVDNLDDGYRWRKYGQKVVKGNPYPRF

superfamily: SSF118290
IPR003657
631-661 WRKY DNA-binding domain
DNA-binding WRKY

FQTTSEVDNLDDGYRWRKYGQKVVKGNPYPR

ProfileScan: PS50811
IPR003657
635-661 WRKY
DNA-binding WRKY

SEVDNLDDGYRWRKYGQKVVKGNPYPR

HMMPfam: PF03106
IPR003657
640-661 WRKY
DNA-binding WRKY

LDDGYRWRKYGQKVVKGNPYPR

HMMSmart: SM00774
IPR003657
640-689 DNA binding domain
DNA-binding WRKY

LDDGYRWRKYGQKVVKGNPYPRFSSSKDYDVVIRYGRADISNEDFISHLR

superfamily: SSF52200
IPR000157
656-786 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

GNPYPRFSSSKDYDVVIRYGRADISNEDFISHLRASLCRRGISVYEKFNEVDALPKCRVLIIVLTSTYVPSNLLNILEHQHTEDRVVYPIFYRLSPYDFVCNSKNYERFYLQDEPKKWQAALKEITQMPGY

superfamily: SSF52540
815-1021 P-loop containing nucleoside triphosphate hydrolases

NMIGMDMQVEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDHVYEVKPLDIPKSLLLLDRGTCQIVLSPEVYKTLSLELVKFSNGNPQVLQFLSSI

HMMPfam: PF00931
IPR002182
821-1083 NB-ARC,NBS
NB-ARC

MQVEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDHVYEVKPLDIPKSLLLLDRGTCQIVLSPEVYKTLSLELVKFSNGNPQVLQFLSSIDREWNKLSQEVKTTSPIYIPGIFEKSCCGLDDNERGIFLDIACFFNRIDKDNVAMLLDGCGF

Gene3D: G3DSA:3.40.50.300
823-956 no description

VEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRN

Seg: seg
824-835 seg

EEILSLLCIESL

FPrintScan: PR00364
IPR000767
839-854 DISEASERSIST
Disease resistance protein

SIGIWGTVGIGKTTIA

FPrintScan: PR00364
IPR000767
915-929 DISEASERSIST
Disease resistance protein

RLQRKRILVILDDVN

superfamily: SSF52058
1119-1446 L domain-like,LRR

IVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLKFDANPNVFEKMCNLRLLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALD

Gene3D: G3DSA:3.80.10.10
1168-1448 no description

NPNVFEKMCNLRLLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDEL

HMMPfam: PF07725
IPR011713
1228-1247 LRR_3
Leucine-rich repeat 3

NLVELNLPSSCAKKLWKGKK

HMMPanther: PTHR24361
1255-1894 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

SSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDELLFVDSRRNSPVVTNPNANSTELMPSESSKLEILGTPADNEVVVGGTVEKTRGIERTPTILVKSREYLIPDDVVAVGGDIKGLRPPVLQLQPAMKLSHIPRGSTWDFVTHFAPPETVAPPSSSSEAREEEVETEETGAMFIPLGDKETCSFTVNKGDSSRTISNTSPIYASEGSFITCWQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVILNPKDYDGYGTPADIWSLGCTVLEMLTGQIPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEERPTAAELLNHPFVNMPLPSSGSGSVSSLLR

HMMPanther: PTHR24361:SF63
1255-1894 SUBFAMILY NOT NAMED

SSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDELLFVDSRRNSPVVTNPNANSTELMPSESSKLEILGTPADNEVVVGGTVEKTRGIERTPTILVKSREYLIPDDVVAVGGDIKGLRPPVLQLQPAMKLSHIPRGSTWDFVTHFAPPETVAPPSSSSEAREEEVETEETGAMFIPLGDKETCSFTVNKGDSSRTISNTSPIYASEGSFITCWQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVILNPKDYDGYGTPADIWSLGCTVLEMLTGQIPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEERPTAAELLNHPFVNMPLPSSGSGSVSSLLR

Seg: seg
1293-1307 seg

SLLSLSQSISYLKKL

FPrintScan: PR00364
IPR000767
1325-1341 DISEASERSIST
Disease resistance protein

VDLESLEVLNLSGCSKL

HMMPfam: PF00560
IPR001611
1329-1346 LRR_1
Leucine-rich repeat

SLEVLNLSGCSKLGNFPE

HMMPfam: PF00560
IPR001611
1397-1415 LRR_1
Leucine-rich repeat

HLETLNLSGCISLERFPDS

Seg: seg
1564-1583 seg

VAPPSSSSEAREEEVETEET

Gene3D: G3DSA:3.30.200.20
1590-1734 no description

LGDKETCSFTVNKGDSSRTISNTSPIYASEGSFITCWQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQIL

superfamily: SSF56112
IPR011009
1612-1878 Protein kinase-like (PK-like)
Protein kinase-like domain

TSPIYASEGSFITCWQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVILNPKDYDGYGTPADIWSLGCTVLEMLTGQIPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEERPTAAELLNHPFVN

HMMSmart: SM00219
IPR020635
1626-1877 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

WQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVILNPKDYDGYGTPADIWSLGCTVLEMLTGQIPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEERPTAAELLNHPFV

HMMPfam: PF00069
IPR000719
1626-1877 Pkinase,Ser-thr
Protein kinase, catalytic domain

WQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVILNPKDYDGYGTPADIWSLGCTVLEMLTGQIPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEERPTAAELLNHPFV

ProfileScan: PS50011
IPR000719
1626-1877 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVILNPKDYDGYGTPADIWSLGCTVLEMLTGQIPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEERPTAAELLNHPFV

HMMSmart: SM00220
IPR002290
1626-1877 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

WQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVILNPKDYDGYGTPADIWSLGCTVLEMLTGQIPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEERPTAAELLNHPFV

Gene3D: G3DSA:1.10.510.10
1735-1879 no description

DGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVILNPKDYDGYGTPADIWSLGCTVLEMLTGQIPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEERPTAAELLNHPFVNM

Seg: seg
1880-1893 seg

PLPSSGSGSVSSLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox