PRGDB00047999 (AT4g12370)

From PRG Wiki
Jump to: navigation, search
AT4g12370
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7267889 (AL161533)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 33.

DNA Sequence

GGATTTGTTCCGGAGCCTCTGGTTGGTATCTGTTACCCGGCCACTGAAATACCGAGTTGGTTCTGCCACCAAAGACTAGGACGTTCACTAGAAATCCCATTGCCTCCGCACTGGTGTGATATTAACTTTGTTGGACTTGCGTTATCTGTAGTTGTCTCATTCAAGGACTATGAAGACAGTGCGAAACGTTTCTCGGTAAAGTGTTGTGGCAACTTCGAGAACAAAGACAGTTCCTTCACGAGATTTGATTTCACTCTCGCAGGCTGGAACGAACCATGTGGATCCCTTAGCCATGAATCAAGAAAGCTCACTTCTGACCACGTTTTCATGGGATACAACAGTTGTTTTCTCGTCAAAAATGTCCATGGAGAGAGTAACAGCTGTTGCTACACAAAGGCTTCGTTCGAATTCTATGTGACAGATGATGAAACAAGGAAGAAGATAGAAACTTGTGAAGTGATAAAATGTGGGATGAGTTTAATGTATGTTCCTGAAGATGATGATTGTATGTTGCTAAAGAAGACAAATATAGTTCAGCTGAGTTTGAAGAGCGGACCAAGTTGTTCCTACGATCTTGATGATGTTATGGATGACGTTAGACCCAAGAGAGGACTTTGCCAGTTTGTTGGTGGTGAAGAACCAGGTTGTAAGAGAAGGAAGGAGGAGAAGATCACAGTGAGATAGGATGTTGGAATGCTCAAATGGGTCGACCTTAGTCATTCTATAAATTTACGTCAGTGTTTGGGTTTGGCTAATGCTCATAATCTTGAGAGGTTGAATCTAGAAGGATGTACAAGTTTGAAAAAATTGCCGTCAACGATAAATTGTTTGGAGAAGCTTATATACCTCAATCTCAGGGATTGCACAAGCCTTAGGAGTCTTCCAAAAGGAATCAAAACTCAATCCTTGCAAACTCTTATTCTCAGTGGCTGCTCCAGCTTAAAGAAATTCCCACTGATCTCGGAAAATGTTGAAGTTCTACTTTTAGATGGCACTGTTATAAAGAGCCTTCCCGAATCCATTCAAACCTTTAGAAGACTTGCTTTGCTGAATCTGAAGAACTGCAAAAAGCTGAAGCATCTTTCTTCTGATCTTTATAAGCTGAAATGTCTTCAAGAGCTAATACTCTCAGGTTGCTCACAACTAGAGGTTTTTCCAGAAATTAAGGAAGACATGGAATCTTTGGAGATTTTACTTATGGATGATACATCCATCACAGAGATGCCAAAGATGATGCATTTGAGCAATATCAAGACATTTTCGTTATGTGGTACAAGCAGTCACGTTTCTGTTAGTATGTTCTTCATGCCACCTACATTGGGCTGCTCTCGGTTAACAGATCTTTACCTCTCAAGATGCAGTCTCTACAAACTCCCAGATAATATCGGTGGCCTATCCTCTTTGCAGTCTTTATGCTTAAGCGGAAACAACATCGAGAATCTTCCAGAAAGCTTCAACCAACTTAACAATCTGAAATGGTTTGATCTTAAGTTTTGCAAAATGCTCAAGTCTCTACCAGTCCTTCCACAAAACCTGCAGTATCTGGATGCACACGAATGCGAGTCACTTGAAACTTTGGCAAATCCATTGACGCCTTTGACAGTAGGAGAGAGAATCCATTCTATGTTCATCTTTAGCAACTGTTACAAACTGAACCAAGACGCACAAGCGAGTCTCGTGGGTCATGCTCGAATCAAAAGTCAGTTAATGGCTAATGCTTCTGCAAAACGTTATTATCGGGGAACTGATAAGATAAGAGGCATTTTTCTCGACACATCAAAACTAAGAGCAATGCGTCTAAGTGCCAAAGCCTTCCAAGGGATGTACAATCTCAAATACTTGAAAATTTATGATTCTCATTGTTCCCGTGGATGCGAAGCAGAGTTTAAACTACACTTGCGGAGGGGACTTAGTTTCCTTCCTAACGAGCTTACATATCTACACTGGCATGGTTATCCACTACAGAGTATCCCTCTAGACTTTGACCCTAAGAATCTTGTAGACCTTAAATTGCCACATAGTCAATTAGAAGAAATTTGGGATGATGAAAAGCACGTCTGAGGCCAAACTTGTTGATGAAATAGCCGTTGACACATTCAAGAAGTTGAATGATTTGGCTCCAAGCGGGAACGAAGGTCTCGTGGGGATAGAATCGCGTCTGAAGAATCTTGAAAAGTTGTTATCATGGGAGGATTTGGATACCGTTCATATCATAGGCATTGTTGGAATGGTTGGGATTGGGAAAACGACTCTTGCTGATTGTTTGTATGGACGTATGCGTGGTCAGTTCGACGGTAGCTGCTTCCTTACTAATATCCGCGAAAATTCAGGTAGAAGCGGGTTAGAATCTTTGCTGCAGAAACTCTTTTCCACTGTACTTAATGATAGAGATTTGGAGATTGGAGCTCCTGGAAATGCACATGAGAGATTTGAGCGGCGGCTTAAGAGCAAGAGGCTACTTATTGTGCTTGATGATGTGAATGATGAAAAGCAAATCAGATATCTTATGGGGCATTGCAAATGGTATCAAGGAGGAAGTAGAATTATCATTACTACTAGAGATAGTAAACTGATTGAGACGATCAAAGGCCGAAAATACGTGCTCCCGAAATTGAATGATAGAGAAGCCTTGAAGCTCTTTAGCTTGAATGCTTTTAGTAACTCTTTCCCTTTGAAAGAGTTCGAAGGTTTGACAAATATGGTTCTTGATTACGCTAAAGGCCACCCTTTGGCTCTTAAGGTGTTAGGATCTGATCTTTGTGAGAGGGATGATCTGTACTGGGAAGCTAAACTGGATAGACTGAAAAGTAGATCACATGGAGATATCTACGAAGTTCTAGAAACAAGCTATGAGGAGCTTACCACTGAACAGAAGAATGTTTTTCTGGATATTGCATGTTTCTTCAGATCAGAGAATGTGGATTACGTGACAAGCCTTCTCAACAGTCATGGTGTGGACGTCTCTGGCGTGGTAAAGGATCTCGTTGACAAATGTCTGATCACTCTTTCTGATAATCGCATCGAGATGCATGACATGTTGCAAACGATGGCCAAGGAGATTAGTTTAAAAGTAGAAACAATAGGTATAAGAGACTGTAGGTGGCTATCACGACATGGTAACCAGTGCCAATGGCATATCAGATTATGGGACAGTGAAGATATTTGTGACCTGCTAACCGAAGGCCTGATGGAATCATCTTCTCCATCTTCAGCAGAGTTCGATGTGTTTCTCAGTTTCAGAGGCTTTGACACACGCAACAACTTCACCGGTCATCTCCAAAAAGCACTTCGTCTAAGAGGAATCGACTCATTCATCGACGACAGACTCCGTCGAGGAGACAATCTCACTGCGCTTTTCGATAGAATCGAGAAATCCAAGATTGCAATCATCGTCTTCTCCACGAACTATGCAAATTCTGCGTGGTGTCTTCGAGAGTTAGTGAAGATCCTCGAATGTAGGAACAGCAACCAACAGCTAGTGGTACCAATCTTCTACAAAGTTGACAAATCGGACGTCGAGAAACAGAGGAATAGTTTTGCGGTGCCGTTCAAGTTACCAGAATTGACTTTTCCCGGAGTTACGCCGGAAGAAATTTCATCGTGGAAGGCTGCTCTTGCCTCAGCATCCAACATCCTAGGTTATGTAGTCAAGGAAATTAG


Protein sequences

Name Description Sequence
putative disease resistance protein (TMV N-like) putative disease resistance protein (TMV N-like) [Arabidopsis thaliana].

MESSSPSSAEFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNILGYVVKEISTSEAKLVDEIAVDTFKKLNDLAPSGNEGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVGERIHSMFIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYYRGFVPEPLVGICYPATEIPSWFCHQRLGRSLEIPLPPHWCDINFVGLALSVVVSFKDYEDSAKRFSVKCCGNFENKDSSFTRFDFTLAGWNEPCGSLSHESRKLTSDHVFMGYNSCFLVKNVHGESNSCCYTKASFEFYVTDDETRKKIETCEVIKCGMSLMYVPEDDDCMLLKKTNIVQLSLKSGPSCSYDLDDVMDDVRPKRGLCQFVGGEEPGCKRRKEEKITVR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MESSSPSSAEFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNILGY

Gene3D: G3DSA:3.40.50.10140
8-144 G3DSA:3.40.50.10140

SAEFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALA

ProfileScan: PS50104
IPR000157
9-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AEFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNI

HMMSmart: SM00255
IPR000157
10-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNI

HMMPfam: PF01582
IPR000157
13-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAAL

HMMPanther: PTHR11017
37-1160 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNILGYVVKEISTSEAKLVDEIAVDTFKKLNDLAPSGNEGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVGERIHSMFIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYYRGFVPEPLVGICYPATEIPSWFCHQRLGRSLEIPLPPHWCDINFVGLALSVVVSFKDYEDSAKRFSVKCCGNFENKDSSFTRFDFTLAGWNEPCGSLSHESRKLTSDHVFMGYNSCFLVKNVHGESNSCCYTKASFEFYVTDDETRKKIETCEVIKCGMSLMYVPEDDD

HMMPanther: PTHR11017:SF20
37-1160 PTHR11017:SF20,SUBFAMILY NOT NAMED

RGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNILGYVVKEISTSEAKLVDEIAVDTFKKLNDLAPSGNEGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVGERIHSMFIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYYRGFVPEPLVGICYPATEIPSWFCHQRLGRSLEIPLPPHWCDINFVGLALSVVVSFKDYEDSAKRFSVKCCGNFENKDSSFTRFDFTLAGWNEPCGSLSHESRKLTSDHVFMGYNSCFLVKNVHGESNSCCYTKASFEFYVTDDETRKKIETCEVIKCGMSLMYVPEDDD

superfamily: SSF52540
185-416 SSF52540

EGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDI

Gene3D: G3DSA:3.40.50.300
187-335 G3DSA:3.40.50.300

LVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETI

HMMPfam: PF00931
IPR002182
195-447 NB-ARC,NBS
NB-ARC

KNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENV

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

IIGIVGMVGIGKTTLA

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

RLKSKRLLIVLDDVN

FPrintScan: PR00364
IPR000767
379-393 DISEASERSIST
Disease resistance protein

AKGHPLALKVLGSDL

superfamily: SSF46785
414-533 SSF46785

GDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLT

superfamily: SSF52058
482-933 SSF52058,LRR

EMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECE

Gene3D: G3DSA:3.80.10.10
546-834 G3DSA:3.80.10.10

LDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSL

ProfileScan: PS51450
IPR001611
621-642 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVDLKLPHSQLEEIWDDEKDV

HMMPfam: PF07725
IPR011713
621-640 LRR_3
Leucine-rich repeat 3

NLVDLKLPHSQLEEIWDDEK

ProfileScan: PS51450
IPR001611
667-689 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLERLNLEGCTSLKKLPSTINCL

FPrintScan: PR00364
IPR000767
710-726 DISEASERSIST
Disease resistance protein

IKTQSLQTLILSGCSSL

ProfileScan: PS51450
IPR001611
806-827 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEILLMDDTSITEMPKMMHLS

Gene3D: G3DSA:3.80.10.10
848-944 G3DSA:3.80.10.10

MPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTP

HMMPfam: PF13855
855-912 LRR_8,Leucine rich repeat

SRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCK

ProfileScan: PS51450
IPR001611
856-877 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTDLYLSRCSLYKLPDNIGGL

ProfileScan: PS51450
IPR001611
879-900 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQSLCLSGNNIENLPESFNQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox