PRGDB00048000 (AT4g11070)

From PRG Wiki
Jump to: navigation, search
AT4g11070
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7267761 (AL161518)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 30.

DNA Sequence

ATGGGTAGTTGTATCTCTCTCCAAATATCATGTGATCAAGTGCTCACTCGTGCATATAGTTGTTTTTTTAGCCTAGGCAATTATATTCACAAACTCAAGGATAATATAGTGGCTCTTGAGAAAGCCATTGAAGATCTCACAGCCACACGAGATGATGTGTTGAGAAGGGTGCAAATGGAAGAAGGAAAAGGTCTAGAGAGGCTCCAACAAGTCCAGGTATGGCTCAAGAGAGTCGAGATTATTCGAAACCAATTCTATGACTTGTTAAGTGCTCGTAATATTGAAATTCAAAGATTGTGTTTTTATAGTAATTGTTCAACGAATTTAAGCTCGAGTTATACGTACGGTCAACGTGTGTTTTTGATGATAAAGGAAGTTGAAAATCTCAATTCTAATGGATTTTTTGAGATAGTAGCTGCTCCAGCTCCAAAACTTGAGATGAGGCCTATTCAACCAACCATTATGGGTCGGGAAACAATTTTTCAAAGGGCTTGGAATCGTCTTATGGATGATGGAGTCGGAACTATGGGTCTATATGGTATGGGGGGAGTAGGCAAAACCACCCTTCTCACGCAGATTCACAATACGTTACATGATACAAAGAATGGGGTTGACATTGTGATTTGGGTTGTGGTGTCTAGTGATCTACAAATCCACAAGATTCAAGAAGATATTGGCGAAAAATTAGGATTTATAGGTAAAGAATGGAACAAGAAACAAGAAAGCCAGAAGGCCGTTGATATACTCAATTGCCTAAGCAAGAAGAGATTTGTGTTGCTTTTGGATGACATATGGAAGAAAGTGGATTTAACAAAGATTGGAATTCCGAGTCAGACAAGAGAAAACAAATGCAAAGTAGTATTCACCACTCGTTCTCTAGATGTATGTGCACGCATGGGGGTTCACGATCCAATGGAAGTTCAATGTTTGTCAACAAATGACGCATGGGAGTTGTTCCAAGAAAAAGTTGGACAAATATCTTTAGGAAGCCATCCAGATATTCTTGAACTTGCCAAAAAGGTTGCTGGAAAATGTCGTGGCTTACCATTGGCACTCAACGTCATTGGCGAAACCATGGCAGGCAAGAGGGCGGTGCAAGAATGGCATCATGCAGTTGATGTTTTAACTTCATATGCTGCAGAGTTTTCTGGCATGGACGACCATATCCTTCTGATTTTGAAGTATAGCTATGACAATCTAAATGACAAGCATGTTAGGTCTTGTTTCCAATATTGCGCTTTATATCCTGAAGATTATTCAATAAAGAAGTATAGATTGATAGATTATTGGATATGCGAGGGATTCATTGATGGTAATATAGGCAAGGAAAGAGCTGTAAATCAAGGTTATGAGATACTTGGTACTCTTGTCCGTGCATGTTTATTGTCCGAGGAAGGAAAGAACAAATTAGAAGTGAAAATGCACGATGTGGTTCGTGAAATGGCTCTTTGGACATTATCTGATCTTGGGAAGAATAAAGAGAGATGTATTGTTCAAGCTGGATCCGGGTTACGTAAAGTACCAAAGGTTGAGGATTGGGGAGCTGTGAGAAGGTTGTCACTGATGAATAATGGGATTGAAGAGATATCTGGCAGTCCTGAGTGTCCTGAACTCACAACTCTCTTCCTCCAGGAAAATAAATCACTGGTACATATCTCGGGTGAATTCTTCCGGCATATGCGAAAGCTAGTTGTTTTAGATCTATCAGAAAACCACCAGCTCGATGGATTGCCAGAGCAAATATCGGAGTTGGTCGCCTTGAGATATCTCGATTTGTCACATACAAACATAGAGGGGCTGCCTGCTTGTCTCCAAGATTTGAAAACATTAATACATTTGAATTTGGAGTGTATGAGGAGACTTGGGAGTATAGCTGGTATATCGAAGTTGTCGAGTTTAAGAACACTAGGACTAAGAAATTCTAATATTATGCTAGATGTTATGTCAGTGAAGGAGCTGCATTTATTGGAACATCTAGAGATTTTAACCATAGATATTGTGTCAACTATGGTTTTGGAGCAAATGATTGACGCTGGCACTTTGATGAATTGTATGCAAGAGGTATCTATTCGTTGTCTCATTTATGACCAAGAACAAGACACAAAGTTACGTCTGCCAACTATGGATAGCCTTCGTAGTCTGACCATGTGGAACTGTGAAATTTCAGAGATAGAGATAGAGAGGTTAACATGGAACACAAATCCAACAAGTCCATGTTTCTTCAACCTCTCCCAAGTCATTATTCATGTTTGTTCTAGTCTCAAGGATTTGACTTGGCTATTGTTTGCTCCGAACATTACTTATCTCATGATTGAGCAGTTGGAGCAGCTACAAGAATTAATTAGTCACGCAAAAGCCACCGGTGTTACTGAGGAGGAGCAGCAACAACTGCATAAGATTATTCCTTTCCAGAAATTACAAATTCTACACTTGTCTAGTTTACCTGAGCTAAAGAGCATCTATTGGATTTCTCTGTCTTTTCCATGCCTAAGTGGAATCTACGTGGAAAGATGTCCAAAGCTGAGAAAACTTCCATTGGATTCTAAAACTGGTACCGTTGGAAAGAAGTTTGTCCTACAATACAAAGAAACAGAATGGATCGAGAGTGTTGAATGGAAGGATGAAGCCACTAAACTCCATTTCTTACCATCAACCAAACTGGTGTATATCCTCTCCTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MGSCISLQISCDQVLTRAYSCFFSLGNYIHKLKDNIVALEKAIEDLTATRDDVLRRVQMEEGKGLERLQQVQVWLKRVEIIRNQFYDLLSARNIEIQRLCFYSNCSTNLSSSYTYGQRVFLMIKEVENLNSNGFFEIVAAPAPKLEMRPIQPTIMGRETIFQRAWNRLMDDGVGTMGLYGMGGVGKTTLLTQIHNTLHDTKNGVDIVIWVVVSSDLQIHKIQEDIGEKLGFIGKEWNKKQESQKAVDILNCLSKKRFVLLLDDIWKKVDLTKIGIPSQTRENKCKVVFTTRSLDVCARMGVHDPMEVQCLSTNDAWELFQEKVGQISLGSHPDILELAKKVAGKCRGLPLALNVIGETMAGKRAVQEWHHAVDVLTSYAAEFSGMDDHILLILKYSYDNLNDKHVRSCFQYCALYPEDYSIKKYRLIDYWICEGFIDGNIGKERAVNQGYEILGTLVRACLLSEEGKNKLEVKMHDVVREMALWTLSDLGKNKERCIVQAGSGLRKVPKVEDWGAVRRLSLMNNGIEEISGSPECPELTTLFLQENKSLVHISGEFFRHMRKLVVLDLSENHQLDGLPEQISELVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTLMNCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDSKTGTVGKKFVLQYKETEWIESVEWKDEATKLHFLPSTKLVYILS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF111
7-888 PTHR23155:SF111,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LQISCDQVLTRAYSCFFSLGNYIHKLKDNIVALEKAIEDLTATRDDVLRRVQMEEGKGLERLQQVQVWLKRVEIIRNQFYDLLSARNIEIQRLCFYSNCSTNLSSSYTYGQRVFLMIKEVENLNSNGFFEIVAAPAPKLEMRPIQPTIMGRETIFQRAWNRLMDDGVGTMGLYGMGGVGKTTLLTQIHNTLHDTKNGVDIVIWVVVSSDLQIHKIQEDIGEKLGFIGKEWNKKQESQKAVDILNCLSKKRFVLLLDDIWKKVDLTKIGIPSQTRENKCKVVFTTRSLDVCARMGVHDPMEVQCLSTNDAWELFQEKVGQISLGSHPDILELAKKVAGKCRGLPLALNVIGETMAGKRAVQEWHHAVDVLTSYAAEFSGMDDHILLILKYSYDNLNDKHVRSCFQYCALYPEDYSIKKYRLIDYWICEGFIDGNIGKERAVNQGYEILGTLVRACLLSEEGKNKLEVKMHDVVREMALWTLSDLGKNKERCIVQAGSGLRKVPKVEDWGAVRRLSLMNNGIEEISGSPECPELTTLFLQENKSLVHISGEFFRHMRKLVVLDLSENHQLDGLPEQISELVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTLMNCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDSKTGTVGKKFVLQYKETEWIESVEWKDEATKLHFLPSTKLV

HMMPanther: PTHR23155
7-888 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LQISCDQVLTRAYSCFFSLGNYIHKLKDNIVALEKAIEDLTATRDDVLRRVQMEEGKGLERLQQVQVWLKRVEIIRNQFYDLLSARNIEIQRLCFYSNCSTNLSSSYTYGQRVFLMIKEVENLNSNGFFEIVAAPAPKLEMRPIQPTIMGRETIFQRAWNRLMDDGVGTMGLYGMGGVGKTTLLTQIHNTLHDTKNGVDIVIWVVVSSDLQIHKIQEDIGEKLGFIGKEWNKKQESQKAVDILNCLSKKRFVLLLDDIWKKVDLTKIGIPSQTRENKCKVVFTTRSLDVCARMGVHDPMEVQCLSTNDAWELFQEKVGQISLGSHPDILELAKKVAGKCRGLPLALNVIGETMAGKRAVQEWHHAVDVLTSYAAEFSGMDDHILLILKYSYDNLNDKHVRSCFQYCALYPEDYSIKKYRLIDYWICEGFIDGNIGKERAVNQGYEILGTLVRACLLSEEGKNKLEVKMHDVVREMALWTLSDLGKNKERCIVQAGSGLRKVPKVEDWGAVRRLSLMNNGIEEISGSPECPELTTLFLQENKSLVHISGEFFRHMRKLVVLDLSENHQLDGLPEQISELVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTLMNCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDSKTGTVGKKFVLQYKETEWIESVEWKDEATKLHFLPSTKLV

superfamily: SSF52540
137-381 SSF52540

IVAAPAPKLEMRPIQPTIMGRETIFQRAWNRLMDDGVGTMGLYGMGGVGKTTLLTQIHNTLHDTKNGVDIVIWVVVSSDLQIHKIQEDIGEKLGFIGKEWNKKQESQKAVDILNCLSKKRFVLLLDDIWKKVDLTKIGIPSQTRENKCKVVFTTRSLDVCARMGVHDPMEVQCLSTNDAWELFQEKVGQISLGSHPDILELAKKVAGKCRGLPLALNVIGETMAGKRAVQEWHHAVDVLTSYAAE

HMMPfam: PF00931
IPR002182
158-436 NB-ARC,NBS
NB-ARC

ETIFQRAWNRLMDDGVGTMGLYGMGGVGKTTLLTQIHNTLHDTKNGVDIVIWVVVSSDLQIHKIQEDIGEKLGFIGKEWNKKQESQKAVDILNCLSKKRFVLLLDDIWKKVDLTKIGIPSQTRENKCKVVFTTRSLDVCARMGVHDPMEVQCLSTNDAWELFQEKVGQISLGSHPDILELAKKVAGKCRGLPLALNVIGETMAGKRAVQEWHHAVDVLTSYAAEFSGMDDHILLILKYSYDNLNDKHVRSCFQYCALYPEDYSIKKYRLIDYWICEGFI

Gene3D: G3DSA:3.40.50.300
164-298 G3DSA:3.40.50.300

AWNRLMDDGVGTMGLYGMGGVGKTTLLTQIHNTLHDTKNGVDIVIWVVVSSDLQIHKIQEDIGEKLGFIGKEWNKKQESQKAVDILNCLSKKRFVLLLDDIWKKVDLTKIGIPSQTRENKCKVVFTTRSLDVCAR

HMMSmart: SM00382
IPR003593
172-310 AAA,NBS
AAA+ ATPase domain

GVGTMGLYGMGGVGKTTLLTQIHNTLHDTKNGVDIVIWVVVSSDLQIHKIQEDIGEKLGFIGKEWNKKQESQKAVDILNCLSKKRFVLLLDDIWKKVDLTKIGIPSQTRENKCKVVFTTRSLDVCARMGVHDPMEVQCL

FPrintScan: PR00364
IPR000767
175-190 DISEASERSIST
Disease resistance protein

TMGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

CLSKKRFVLLLDDIW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGETM

superfamily: SSF52058
473-845 SSF52058,LRR

KMHDVVREMALWTLSDLGKNKERCIVQAGSGLRKVPKVEDWGAVRRLSLMNNGIEEISGSPECPELTTLFLQENKSLVHISGEFFRHMRKLVVLDLSENHQLDGLPEQISELVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTLMNCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLP

Gene3D: G3DSA:3.80.10.10
498-675 G3DSA:3.80.10.10

VQAGSGLRKVPKVEDWGAVRRLSLMNNGIEEISGSPECPELTTLFLQENKSLVHISGEFFRHMRKLVVLDLSENHQLDGLPEQISELVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQM

HMMPfam: PF13855
536-597 LRR_8,Leucine rich repeat

PELTTLFLQENKSLVHISGEFFRHMRKLVVLDLSENHQLDGLPEQISELVALRYLDLSHTNI

FPrintScan: PR00364
IPR000767
558-574 DISEASERSIST
Disease resistance protein

RHMRKLVVLDLSENHQL

Gene3D: G3DSA:3.80.10.10
709-849 G3DSA:3.80.10.10

DSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDSK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox