PRGDB00048032 (nbs)

From PRG Wiki
Jump to: navigation, search
nbs
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 166084748 (AM931411)
Gene Class N
Domain Type NBS
Gene Species Musa textilis

Comment?

Musa textilis partial nbs gene for NBS-LRR disease resistance protein, clone NA131_TX.

DNA Sequence

GGCATGGGCGGTGTGGGTAAAACAGTGCTAGCGCAGATGGTCTTCAACAGTCCGCAGGTGAGAAGGCGCTTCTTTCCGCGGCTATGGGTGTGCATGTCTCAGACGGTGAAAAGAGGTAGAGATGTCCGAAGAGAGATGTTGGAGAGGATGCTAATGGCACTGGGAGTCGAGGACGAGGCCATCACATCCATCTCAGAAGCCGGTGCAGGAAGCGGTGGCCTCGCCGAGTTGATGTTCGCGCTCCACCTCCAATTGATGAACAAAAGATATCTCATCGTCTTCGACGACGTCTGGAACATCGACGAATGGTACGAAGGATTAATGAGCTCGGGTTTGCCGGACGAAGGTTTATGGGCTGGTCATCTTCGTCTTGACCGTGTGTTGCCGAAGGACTGCGGCGGGTCGGTCATCGTCACAAGCAGATTGGAGGAGGTGGCTGTGAAGATGGTCGGGAAAGAGAACATGTGTCGGATCGAGCCCGATAAAGACGGGGAATTTTGTTGGAATATATTCATGGATTCAGTGACGGAGGGCGGGCTTGCGGACGATCATCCTACTCTGAGAAGCATGAAGACAGAGATCGTGGATAGATGTGGTGGCCTCCCCC


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Musa textilis].

GMGGVGKTVLAQMVFNSPQVRRRFFPRLWVCMSQTVKRGRDVRREMLERMLMALGVEDEAITSISEAGAGSGGLAELMFALHLQLMNKRYLIVFDDVWNIDEWYEGLMSSGLPDEGLWAGHLRLDRVLPKDCGGSVIVTSRLEEVAVKMVGKENMCRIEPDKDGEFCWNIFMDSVTEGGLADDHPTLRSMKTEIVDRCGGLP


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-202 SSF52540

GMGGVGKTVLAQMVFNSPQVRRRFFPRLWVCMSQTVKRGRDVRREMLERMLMALGVEDEAITSISEAGAGSGGLAELMFALHLQLMNKRYLIVFDDVWNIDEWYEGLMSSGLPDEGLWAGHLRLDRVLPKDCGGSVIVTSRLEEVAVKMVGKENMCRIEPDKDGEFCWNIFMDSVTEGGLADDHPTLRSMKTEIVDRCGGLP

HMMPfam: PF00931
IPR002182
1-104 NB-ARC,NBS
NB-ARC

GMGGVGKTVLAQMVFNSPQVRRRFFPRLWVCMSQTVKRGRDVRREMLERMLMALGVEDEAITSISEAGAGSGGLAELMFALHLQLMNKRYLIVFDDVWNIDEWY

HMMPfam: PF00931
IPR002182
130-202 NB-ARC,NBS
NB-ARC

KDCGGSVIVTSRLEEVAVKMVGKENMCRIEPDKDGEFCWNIFMDSVTEGGLADDHPTLRSMKTEIVDRCGGLP


List of References

M Azhar, J S Heslop-Harrison
Genomes, diversity and resistance gene analogues in Musa species.
Cytogenet. Genome Res.: 2008, 121(1);59-66
PubMed:18544928 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox