PRGDB00048072 (nbs)

From PRG Wiki
Jump to: navigation, search
nbs
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 166084668 (AM931371)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Musa AAB Group

Comment?

Musa AAB Group partial nbs gene for NBS-LRR disease resistance protein, cultivar Pisang Ceylan, clone N321_MY.

DNA Sequence

GGAATGGGAGGGGTGGGTAAGACTACTCTTGCTCAGCATGCCTACCACCACGAGAAGGTGAAGGACTATTTTCATCATAAGGTCTGGGTCTGTGTATCCGACGACTTCAACGTGGAGAGGCTTACAAAAGAGATCATAGAATCCTTAACCCGAAAGACGTGTGATCTCAGCAACCTTAATACACTTCAAGAGGAAGTTAAGGAGAAGTTGACCTCAAAGAGGTTCCTTCTTGTCCTCGACGATGTGTGGGACGAGAACAGACAGAACTGGGATAGATTTCGTGCACCATTGGGGTACGGAGTACCAGGAAGCAAGATTTTGGTTACAACTCGCTCTGAAAAGATTGCAGAAATGGTTGGCAATCGGATCCATCTAGGAGGTCTGGATGAAGCCAGCTATTGGAAATTGTTCAAAAAATGTGCATTTGGTTCCGAAGACGCCGGTGAATTTCCACAGCTAGAAGCCATAGCAAAGAAGATCGTTGGCAGGTTGAAGGGGTTACCGTTGGCGGCAAAGACG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Musa AAB Group].

GMGGVGKTTLAQHAYHHEKVKDYFHHKVWVCVSDDFNVERLTKEIIESLTRKTCDLSNLNTLQEEVKEKLTSKRFLLVLDDVWDENRQNWDRFRAPLGYGVPGSKILVTTRSEKIAEMVGNRIHLGGLDEASYWKLFKKCAFGSEDAGEFPQLEAIAKKIVGRLKGLPLAAKT

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-173 SSF52540

GMGGVGKTTLAQHAYHHEKVKDYFHHKVWVCVSDDFNVERLTKEIIESLTRKTCDLSNLNTLQEEVKEKLTSKRFLLVLDDVWDENRQNWDRFRAPLGYGVPGSKILVTTRSEKIAEMVGNRIHLGGLDEASYWKLFKKCAFGSEDAGEFPQLEAIAKKIVGRLKGLPLAAKT

HMMPanther: PTHR23155:SF121
1-97 PTHR23155:SF121,SUBFAMILY NOT NAMED

GMGGVGKTTLAQHAYHHEKVKDYFHHKVWVCVSDDFNVERLTKEIIESLTRKTCDLSNLNTLQEEVKEKLTSKRFLLVLDDVWDENRQNWDRFRAPL

HMMPfam: PF00931
IPR002182
1-172 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAQHAYHHEKVKDYFHHKVWVCVSDDFNVERLTKEIIESLTRKTCDLSNLNTLQEEVKEKLTSKRFLLVLDDVWDENRQNWDRFRAPLGYGVPGSKILVTTRSEKIAEMVGNRIHLGGLDEASYWKLFKKCAFGSEDAGEFPQLEAIAKKIVGRLKGLPLAAK

Gene3D: G3DSA:3.40.50.300
1-124 G3DSA:3.40.50.300

GMGGVGKTTLAQHAYHHEKVKDYFHHKVWVCVSDDFNVERLTKEIIESLTRKTCDLSNLNTLQEEVKEKLTSKRFLLVLDDVWDENRQNWDRFRAPLGYGVPGSKILVTTRSEKIAEMVGNRIH

HMMPanther: PTHR23155
1-97 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGVGKTTLAQHAYHHEKVKDYFHHKVWVCVSDDFNVERLTKEIIESLTRKTCDLSNLNTLQEEVKEKLTSKRFLLVLDDVWDENRQNWDRFRAPL

FPrintScan: PR00364
IPR000767
69-83 DISEASERSIST
Disease resistance protein

KLTSKRFLLVLDDVW

FPrintScan: PR00364
IPR000767
164-173 DISEASERSIST
Disease resistance protein

LKGLPLAAKT


List of References

M Azhar, J S Heslop-Harrison
Genomes, diversity and resistance gene analogues in Musa species.
Cytogenet. Genome Res.: 2008, 121(1);59-66
PubMed:18544928 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox