PRGDB00048082 (nbs)

From PRG Wiki
Jump to: navigation, search
nbs
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 166084648 (AM931361)
Gene Class NL
Domain Type NBS, LRR
Gene Species Musa acuminata subsp. malaccensis

Comment?

Musa acuminata subsp. malaccensis partial nbs gene for NBS-LRR disease resistance protein, clone N273_ML.

DNA Sequence

GGAATGGGGGGTGTGGGCAAAACTACTCTTGCTCAGCAAGCCTACAACCACGAGAGGGTGCAGGACTATTTTCAGCATGAGGTCTGGGTCTGTGTATCAGACAACTTCAACGTGGAAAGGCTTACCAAAGAGATCATAGAATCCATAACCGAGAATAAGTGTGATCTCAGCAACCTTGATACACTTCAAGTGGTTCTTAAGAAGAACTTGACCTCAAAAAGGTTCCTGCTTGTCCTCGACGATGTGTGGAACGAGGACAGCCTGAAATGGGAAAGATTTTGTGCACCATTGAGGTACGGAGAACCAGGAAGCAAGATTTTGGTTACAACTCGCTCTAAAAAGATTGCAAAAATGGTTGGCAATCCGATCCCTCTAGGAGGTCTGGATGAAGCCAGCTATTGGAAATTGTTCAAGAAATGTGCATTTGGGTCCGAAGACGCCGGTGAATTTCCACATCTAGAAGCCATAGCAAAGAAGATCGCTGGCAGGTTGAAGGGGTTTCCGTTGGCGGCAAAGACG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Musa acuminata subsp. malaccensis].

GMGGVGKTTLAQQAYNHERVQDYFQHEVWVCVSDNFNVERLTKEIIESITENKCDLSNLDTLQVVLKKNLTSKRFLLVLDDVWNEDSLKWERFCAPLRYGEPGSKILVTTRSKKIAKMVGNPIPLGGLDEASYWKLFKKCAFGSEDAGEFPHLEAIAKKIAGRLKGFPLAAKT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
1-172 PTHR11017:SF28

GMGGVGKTTLAQQAYNHERVQDYFQHEVWVCVSDNFNVERLTKEIIESITENKCDLSNLDTLQVVLKKNLTSKRFLLVLDDVWNEDSLKWERFCAPLRYGEPGSKILVTTRSKKIAKMVGNPIPLGGLDEASYWKLFKKCAFGSEDAGEFPHLEAIAKKIAGRLKGFPLAAK

HMMPfam: PF00931
IPR002182
1-172 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAQQAYNHERVQDYFQHEVWVCVSDNFNVERLTKEIIESITENKCDLSNLDTLQVVLKKNLTSKRFLLVLDDVWNEDSLKWERFCAPLRYGEPGSKILVTTRSKKIAKMVGNPIPLGGLDEASYWKLFKKCAFGSEDAGEFPHLEAIAKKIAGRLKGFPLAAK

Gene3D: G3DSA:3.40.50.300
1-115 G3DSA:3.40.50.300

GMGGVGKTTLAQQAYNHERVQDYFQHEVWVCVSDNFNVERLTKEIIESITENKCDLSNLDTLQVVLKKNLTSKRFLLVLDDVWNEDSLKWERFCAPLRYGEPGSKILVTTRSKKI

HMMPanther: PTHR11017
1-172 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGVGKTTLAQQAYNHERVQDYFQHEVWVCVSDNFNVERLTKEIIESITENKCDLSNLDTLQVVLKKNLTSKRFLLVLDDVWNEDSLKWERFCAPLRYGEPGSKILVTTRSKKIAKMVGNPIPLGGLDEASYWKLFKKCAFGSEDAGEFPHLEAIAKKIAGRLKGFPLAAK

superfamily: SSF52540
1-173 SSF52540

GMGGVGKTTLAQQAYNHERVQDYFQHEVWVCVSDNFNVERLTKEIIESITENKCDLSNLDTLQVVLKKNLTSKRFLLVLDDVWNEDSLKWERFCAPLRYGEPGSKILVTTRSKKIAKMVGNPIPLGGLDEASYWKLFKKCAFGSEDAGEFPHLEAIAKKIAGRLKGFPLAAKT


List of References

M Azhar, J S Heslop-Harrison
Genomes, diversity and resistance gene analogues in Musa species.
Cytogenet. Genome Res.: 2008, 121(1);59-66
PubMed:18544928 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox