PRGDB00048107 (nbs)

From PRG Wiki
Jump to: navigation, search
nbs
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 166084598 (AM931336)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Musa AAB Group

Comment?

Musa AAB Group partial nbs gene for NBS-LRR disease resistance protein, cultivar Pisang Mutiara, clone N153_MT.

DNA Sequence

GGAATGGGAGGAGTGGGGAAGACGACGCTAGCTCAGCTTGTATATAACGATCCCAGGGTGTCCAACTACTTCGATACGAGGGGATGGATCTGTGTCTCTGAAGAATTTGATGTTGTTGGTTTAACACGAAAGATCTTGGTGTCCTTCTTCAAAACCACAGTTGATTACACAGAATTAAATGAGCTTCAACAAGAACTAAAAGAAAATTTGCAGGGAAAGAAGTTTTTGCTTGTTTTGGATGATGTTTGGAACGAGAAACCTAGTCTTTGGGAGTTGGTGAAAGTCCCCTTACTCAAGGCTGGAGTGGGTAAAGTCTTACTGACTACTCGGAATGAATGTGTTGCCAGAATCATGCAGACGATGGAGCCTTTGAGCTTGAACATCTTATCATTCGACAAATGCTGGATGTTGTTCGAGAAGCTTGCCTTGGAAAGCTTAGAATCCAGCAGCAGGCATAACAATTTGGAGGACATCGGTCGGAAGATCGTCGAGAAGTGCAAAGGGTTACCGTTGGCGGCAAAGACG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Musa AAB Group].

GMGGVGKTTLAQLVYNDPRVSNYFDTRGWICVSEEFDVVGLTRKILVSFFKTTVDYTELNELQQELKENLQGKKFLLVLDDVWNEKPSLWELVKVPLLKAGVGKVLLTTRNECVARIMQTMEPLSLNILSFDKCWMLFEKLALESLESSSRHNNLEDIGRKIVEKCKGLPLAAKT

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-174 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAQLVYNDPRVSNYFDTRGWICVSEEFDVVGLTRKILVSFFKTTVDYTELNELQQELKENLQGKKFLLVLDDVWNEKPSLWELVKVPLLKAGVGKVLLTTRNECVARIMQTMEPLSLNILSFDKCWMLFEKLALESLESSSRHNNLEDIGRKIVEKCKGLPLAAK

HMMPanther: PTHR23155
1-154 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGVGKTTLAQLVYNDPRVSNYFDTRGWICVSEEFDVVGLTRKILVSFFKTTVDYTELNELQQELKENLQGKKFLLVLDDVWNEKPSLWELVKVPLLKAGVGKVLLTTRNECVARIMQTMEPLSLNILSFDKCWMLFEKLALESLESSSRHNN

superfamily: SSF52540
1-175 SSF52540

GMGGVGKTTLAQLVYNDPRVSNYFDTRGWICVSEEFDVVGLTRKILVSFFKTTVDYTELNELQQELKENLQGKKFLLVLDDVWNEKPSLWELVKVPLLKAGVGKVLLTTRNECVARIMQTMEPLSLNILSFDKCWMLFEKLALESLESSSRHNNLEDIGRKIVEKCKGLPLAAKT

HMMPanther: PTHR23155:SF121
1-154 PTHR23155:SF121,SUBFAMILY NOT NAMED

GMGGVGKTTLAQLVYNDPRVSNYFDTRGWICVSEEFDVVGLTRKILVSFFKTTVDYTELNELQQELKENLQGKKFLLVLDDVWNEKPSLWELVKVPLLKAGVGKVLLTTRNECVARIMQTMEPLSLNILSFDKCWMLFEKLALESLESSSRHNN

Gene3D: G3DSA:3.40.50.300
1-95 G3DSA:3.40.50.300

GMGGVGKTTLAQLVYNDPRVSNYFDTRGWICVSEEFDVVGLTRKILVSFFKTTVDYTELNELQQELKENLQGKKFLLVLDDVWNEKPSLWELVKV

FPrintScan: PR00364
IPR000767
69-83 DISEASERSIST
Disease resistance protein

NLQGKKFLLVLDDVW

FPrintScan: PR00364
IPR000767
166-175 DISEASERSIST
Disease resistance protein

CKGLPLAAKT


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox