PRGDB00048109 (nbs)

From PRG Wiki
Jump to: navigation, search
nbs
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 166084594 (AM931334)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Musa velutina

Comment?

Musa velutina partial nbs gene for NBS-LRR disease resistance protein, clone N144_VT.

DNA Sequence

GGGATGGGGGGTGTGGGGAAAACTACTCTTGCTCAGCAAGCCTACAACAACGAGAGGGTGAAGGACTATTTTTATCATAAGGTCTGGGTCTGTGTATCCGACAACTTCAACGTGGAGAGGCTTACCAAAGAGATCAGAGAATCCTTAACCCGGAATACGTGTGATCTCAACAACTTTGATACACTTCAAGTGGAAGTTAAGGAGGCATTGACCTCGAAAAGGTTCCTGCTTGTCCTCGACGATGTGTGGAGCGAGGACAGCCTGAAATGGGAAAGATTTTGTGCACCATTGAAGTACGGAGAACCCGGAAGCAAGATTTTGGTTACGACTCGCTCTAAAAAGATTGCAGACATGGTTGGCAATCCGTTCCCTCTAGATGGTCTGGATGACGCCAGCTATTGGGAATTTTTCAAACAATGTGCATTTGGTTCCGAATACGCCGGTGAATGTCCACAGCTAGAAGCCATAGCAAAGAAGATCGCTTACAGGTTGAATGGCTTGCCTCTCGCTGCAAAGACG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Musa velutina].

GMGGVGKTTLAQQAYNNERVKDYFYHKVWVCVSDNFNVERLTKEIRESLTRNTCDLNNFDTLQVEVKEALTSKRFLLVLDDVWSEDSLKWERFCAPLKYGEPGSKILVTTRSKKIADMVGNPFPLDGLDDASYWEFFKQCAFGSEYAGECPQLEAIAKKIAYRLNGLPLAAKT

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-173 SSF52540

GMGGVGKTTLAQQAYNNERVKDYFYHKVWVCVSDNFNVERLTKEIRESLTRNTCDLNNFDTLQVEVKEALTSKRFLLVLDDVWSEDSLKWERFCAPLKYGEPGSKILVTTRSKKIADMVGNPFPLDGLDDASYWEFFKQCAFGSEYAGECPQLEAIAKKIAYRLNGLPLAAKT

HMMPanther: PTHR11017:SF28
1-172 PTHR11017:SF28

GMGGVGKTTLAQQAYNNERVKDYFYHKVWVCVSDNFNVERLTKEIRESLTRNTCDLNNFDTLQVEVKEALTSKRFLLVLDDVWSEDSLKWERFCAPLKYGEPGSKILVTTRSKKIADMVGNPFPLDGLDDASYWEFFKQCAFGSEYAGECPQLEAIAKKIAYRLNGLPLAAK

HMMPanther: PTHR11017
1-172 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGVGKTTLAQQAYNNERVKDYFYHKVWVCVSDNFNVERLTKEIRESLTRNTCDLNNFDTLQVEVKEALTSKRFLLVLDDVWSEDSLKWERFCAPLKYGEPGSKILVTTRSKKIADMVGNPFPLDGLDDASYWEFFKQCAFGSEYAGECPQLEAIAKKIAYRLNGLPLAAK

Gene3D: G3DSA:3.40.50.300
1-119 G3DSA:3.40.50.300

GMGGVGKTTLAQQAYNNERVKDYFYHKVWVCVSDNFNVERLTKEIRESLTRNTCDLNNFDTLQVEVKEALTSKRFLLVLDDVWSEDSLKWERFCAPLKYGEPGSKILVTTRSKKIADMV

HMMPfam: PF00931
IPR002182
1-172 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAQQAYNNERVKDYFYHKVWVCVSDNFNVERLTKEIRESLTRNTCDLNNFDTLQVEVKEALTSKRFLLVLDDVWSEDSLKWERFCAPLKYGEPGSKILVTTRSKKIADMVGNPFPLDGLDDASYWEFFKQCAFGSEYAGECPQLEAIAKKIAYRLNGLPLAAK

FPrintScan: PR00364
IPR000767
69-83 DISEASERSIST
Disease resistance protein

ALTSKRFLLVLDDVW

FPrintScan: PR00364
IPR000767
164-173 DISEASERSIST
Disease resistance protein

LNGLPLAAKT


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox