PRGDB00048115 (nbs)

From PRG Wiki
Jump to: navigation, search
nbs
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 166084582 (AM931328)
Gene Class NL
Domain Type NBS, LRR
Gene Species Musa ornata

Comment?

Musa ornata partial nbs gene for NBS-LRR disease resistance protein, clone N111_OR.

DNA Sequence

GGAATGGGGGGCGTTGGAAAAACGACGCTGGCTCAGTTCGTGTACAACGATGCCACGGTCAGGAAGCACTTTGAGTTGAAGATTTGGGTCTGTGTATCCGACAGTTTTGACGTGAAGAGACTCACCAAAGAGATTATAGAATCTGTCACCAACGAGAAACAATCTGATCTAATGAACTTGGACACTCTTCAAGTGATCCTAAAGGTGAAGATTGCGTCCAAGAGGTTTCTGCTTGTCCTCGATGATGTGTGGAGCGTCGACACTCACGATATGGACGAGTGGCAAAAACTGTGCGCGCCGTTGAGGTTTGGAGCGCGGGGCAGCATGGTCATGGTGACTACTCGAGATTTGAGGATCGCTAGCATTGTTGGCACGATGAAGGAAATCTTGCTCGAGGGTTTAGAAGATGACGATTACTGGGAATTGTTCAAAAAGTGTGCATTCGGTTCTTTGAATCCCAAGGAGCATCCAGAGCTGGAGGCTATCGGAAGAAAGATCGCTGGCAAGTTGAAGGCCTACCCCTCGCTGCAAAGACG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Musa ornata].

GMGGVGKTTLAQFVYNDATVRKHFELKIWVCVSDSFDVKRLTKEIIESVTNEKQSDLMNLDTLQVILKVKIASKRFLLVLDDVWSVDTHDMDEWQKLCAPLRFGARGSMVMVTTRDLRIASIVGTMKEILLEGLEDDDYWELFKKCAFGSLNPKEHPELEAIGRKIAGKLKAYPSLQRR


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAQFVYNDATVRKHFELKIWVCVSDSFDVKRLTKEIIESVTNEKQSDLMNLDTLQVILKVKIASKRFLLVLDDVWSVDTHDMDEWQKLCAPLRFGARGSMVMVTTRDLRIASIVGTMKEILLEGLEDDDYWELFKKCAFGSLNPKEHPELEAIGRKIAGKLK

Gene3D: G3DSA:3.40.50.300
1-121 G3DSA:3.40.50.300

GMGGVGKTTLAQFVYNDATVRKHFELKIWVCVSDSFDVKRLTKEIIESVTNEKQSDLMNLDTLQVILKVKIASKRFLLVLDDVWSVDTHDMDEWQKLCAPLRFGARGSMVMVTTRDLRIAS

superfamily: SSF52540
1-167 SSF52540

GMGGVGKTTLAQFVYNDATVRKHFELKIWVCVSDSFDVKRLTKEIIESVTNEKQSDLMNLDTLQVILKVKIASKRFLLVLDDVWSVDTHDMDEWQKLCAPLRFGARGSMVMVTTRDLRIASIVGTMKEILLEGLEDDDYWELFKKCAFGSLNPKEHPELEAIGRKIA

HMMPanther: PTHR23155:SF130
3-101 PTHR23155:SF130,OS01G0781700 PROTEIN

GGVGKTTLAQFVYNDATVRKHFELKIWVCVSDSFDVKRLTKEIIESVTNEKQSDLMNLDTLQVILKVKIASKRFLLVLDDVWSVDTHDMDEWQKLCAPL

HMMPanther: PTHR23155
3-101 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAQFVYNDATVRKHFELKIWVCVSDSFDVKRLTKEIIESVTNEKQSDLMNLDTLQVILKVKIASKRFLLVLDDVWSVDTHDMDEWQKLCAPL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox