PRGDB00048176 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186701209 (EF197846)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis halleri

Comment?

Arabidopsis halleri miR319a microRNA locus, genomic sequence.

DNA Sequence

ATGGCATCTCTAGTAGTTAAACAACTCTTCAAATCCCTCTTCTCATTCTTCTTATTAGGTCTACTCTTCTCTGATACCGTCTTATCTTTCCGAAAAACAATTGATCAGAAAAAACCCTGCAAACATTTCTCGTTCTATTTCCATGACATCCTCTACGATGGCGACAATGTAGCAAACGCAACCTCTGCCGCTATCGTAAGCCCTCCGGGACTAGGAAACTTCAAGTTTGGTAAGTTTGTGATCTTCGATGGGCCCATAACAATGGACAAGAACTATCTCTCAAAACCCCTGGCTCGCGCACAAGGCTTCTATTTTTATGACATGAAGATGGACTTCAATGCGTGGTTTTGCTACACGTTGGTGTTTAACTCAACGGAACACAAAGGGACATTGAACATAATGGGTGCTGATTTGATGATGGAGCCAACAAGAGATCTATCGGTCGTTGGTGGGACAGGTGACTTCTTCATGGCTCGTGGGATCGCTACCTTCGTGACGGATTTATTTCAAGGGGCTAAGTATTTCAGAGTCAAGATGGATATTAAGCTCTATGAATGTTACTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis halleri].

MASLVVKQLFKSLFSFFLLGLLFSDTVLSFRKTIDQKKPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGNFKFGKFVIFDGPITMDKNYLSKPLARAQGFYFYDMKMDFNAWFCYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVGGTGDFFMARGIATFVTDLFQGAKYFRVKMDIKLYECY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21495
16-187 PTHR21495,NUCLEOPORIN-RELATED

FFLLGLLFSDTVLSFRKTIDQKKPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGNFKFGKFVIFDGPITMDKNYLSKPLARAQGFYFYDMKMDFNAWFCYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVGGTGDFFMARGIATFVTDLFQGAKYFRVKMDIKLYECY

HMMPfam: PF03018
IPR004265
39-182 Dirigent
Plant disease resistance response protein

PCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGNFKFGKFVIFDGPITMDKNYLSKPLARAQGFYFYDMKMDFNAWFCYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVGGTGDFFMARGIATFVTDLFQGAKYFRVKMDIK


List of References

Norman Warthmann, Sandip Das, Christa Lanz, Detlef Weigel
Comparative analysis of the MIR319a microRNA locus in Arabidopsis and related Brassicaceae.
Mol. Biol. Evol.: 2008, 25(5);892-902
PubMed:18296705 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox