PRGDB00048178 (P0667A10.31)

From PRG Wiki
Jump to: navigation, search
P0667A10.31
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6721534 (AP001073)
Gene Class NL
Domain Type NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0667A10.

DNA Sequence

GTACTTTGTAGTTGTTGATGATGTATGGAGTCTAGAGGACTGGGCAAGCTTGAAGCCAGCTTTCCCAGACAATGATATACACAGTAGAGTAGTTATCACTACGCGGAATCGTCAAGTTGCTGAGAGCTGCTGCTCCCTTCCCGTCGATCGAGTTTACTCCATGGATGTTTTACAAGATGATCAGTCGAGAAAGTTGTTCTTCAACACGGTGTTTCGGTCGAACAAGTGTCCCGCGGGGTATCGGAGATTGGAGACCATCTCCGGCAACATCTTGGCCAAATGCGGTGGCTTGCCACTGGCCATAGTCAGTGTCGGGGGAATGCTGGCTCAGGCGGAGAACAAGACACCGGCGGAGTGGATGAAGGTGTGCGATAGGCTAGGATCTAGGCTGAGCACAAGCGCAATGATGGAAAGGATGAGGCGGATAATGTCACTTAGCTACCATGACCTGCTCTACCATTTGAAGGCTTGCTTCCTCTACCTGAGCGTCTTCCGTGAGGGGTATGAGATCAAGAGGGGGCCATTGGTGCGGCGGTGGGCTGCCGAGGGGTTCGTTGGCGGCAGACGTGAGTGCACACCTGAGGAGGCCGCTGGCAAGTACCTGGACGAGTTCGTCGGCAGGAGCATAGTCACGCCTACAAGGGTTGTCAGCAATGGTGTCGTCAGGTGTTGTAAGGTCCACGACATCATGCTGGAGATGATGACAGAAAAGTGCATGGAGGAAAACTTCATCTCCTTGCTAGGAAGCCCGAGCAAGCATGGCCACCAGCAGCATGCCATGATGGTGGCAGCTGGGCACGACAAGATCCGACGGCTCTCTGTCCATGGCGCGCACACGTCTCAGGGGAAACAAGCTGGTGGTGTTCATGACAAGCATCTTTGTAGGAGGAGGATAAAGAAGGATGAGGAACAAGACGACGTCTTGTCGTCTGGAGACTTGTCTTGTGTCCGCTCACTTCTAATGCTCCGGTGCATCGAGAAACCAATACCGGTAATCAGTTTCGCAAAGCTAAAGCTCATTCGTGTACTAGACCTCGAAGGTTGTCGTTGGTTGAGCAACCATGACTTGGAAGACATTTGTAAGTTGTCTCTCTTGAGGTATCTCAGCCTTAGAGACACCGGTGTGCAGCGGCTCCCACGGTTGATCGGGAGGCTAAAAGAGCTTCTAACACTGGACATCAGGGAAACTGACGTGAGGGCACTACCAGAGACAATCACCCGGTTGGGACGCCTAAGGCATCTACTCGCCGGCAGGTACAGGTACTACACGAGGAGCCATCGTGTCAAGCTCTTCGAGCCGTTCGAGGCTGTGACAATACCACCTGGTCTGGCCGCCATGGGATCCCTCCAGACCATTGCCCATGCCAACATCGCGTCAAGCTCCATTGCCATGGGTGAGCTCGGTGACCTGCCTGGCCTAACCAAGCTATGTGTCATGAACTGCGAGGAAGGGCCTAGCAAATGGGAGCCATTCGTTATCTCCCTCAATAAGCTCAGTTACTCCCTCCGCAGCCTGTCCATCCTTCATTGGCAGTATGACAATGCCGGTCTCGAGGCCCTCCTAGATCTCACTTCACCACCAATCTTCCTCGAGAAGTTCTTCCTTTGGGGTAAGCTCAGCACATTGCCTTCCTGGGTCTCACACCTCAGCAACCTTGTTGACCTCTGTCTTCGGGAGAACTTCCTCAATGGTGAGGTCATCATTGAGCAGCTAGGCAAGCTCCCCAGCCTCCTCTCCCTCAAGCTCTACCGCGCGTCATACCTAGGGAGAGAGCTCCGCTTCCGGGAGAAGCTATTCCCAAGGCTAAAGCAACTCATCGTGGACAATCTACCCAACATTGAGGAGCTCAGCTTCCAAGGAGGCGCCCCTCAGCTTGAGAGGCTCACGCTTGCTGTCCTCAAGAAGCCTGAGGATGGCATTTTCGGCATTGATAAGCTCCCAATGCTCAAGGAGGTTGAGTTCTACGGCCATATCATGATCGATTCTGTGGTGGCAGAGATGGTAGCTGTGTGCAGAAATCATCCGAACAAGCCTAGAGTTTACAGGGAGGATCGACCAATGGAGATGGACTCTGAATCATCCAACTGAACGAGGACGTGGATGAAGCAGGTGAGGGAGGTGGCGTACGACGCGGAGGACTGCATCGACAGCTTCCGGTACCACGTCGGCGGCGACCGGTACCGCGACGAGGACCTCGCCGGCTGGCTGCGCAGGACGGTGCTCCGGCCGCTGACGACGCTGCGGGCGATGTACAAGCTGGCCGTGGAGGTCCAGAGCCTCAAGGCCCGCGCGCTCATGGTCAGCGAGCGGAGGCTGCGTTACAAGCTGGAGCCGCCCGCCGCGGCGTCGAGCTCCGGCGAGTACGCGCCCCGCTGCTACGACGACCTCGACCGCCGTCTTCCGGCACTCAGCGTCGACGAGTCTCGTCGGCGTCCGCAGCAAGACCAGAGCCGTCCTCAAGCTGCTGGACATGGTCGGCGACGACGACGGCTCGGCCCGCCGGAAGGTGGTGTCCATCGTCGGCTTCGGCGGCCTAGGCAAGACGACGCTGGCGGCGATGGTGTACAAGAGCCCCGCGGTGCGGGGCATCCAGCACAGGGCATTCGTGACGGTGACCCGGAGCTGCAACCTTCGAGCTCTGCTGGAATCGTTGGTGGAGCAGCTCTTCGCGCCAATGCGAGATTCACGCTGCTCCACGAAGAAGACGACCACGGATCACGACGAATACTCAGAGGCATCGAAACCAAGGACATTCCCCAACTCCTCGCCCATTGCAGCACTCATTTGAGAGACAAGAGATGGAGGCCGCCGTGGTGAGCTCCACCGAGGGCGTGGTGCACATCCTCCTCGGCAAGCTCGGCGAATTCCTCTCCGACAAGTACGTCCTCCTCAGCGGCGTCCGCCACGAGATCCAGGAGCTCAAGGACGACCTCGAGAGCATGAACGCCTGCCTCCGCGACCTCGCCGCCGCCGGCGACTACCACCAGACCCAGCAG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein -like NBS-LRR disease resistance protein -like [Oryza sativa Japonica Group].

MEAAVVSSTEGVVHILLGKLGEFLSDKYVLLSGVRHEIQELKDDLESMNACLRDLAAAGDYHQTQQTRTWMKQVREVAYDAEDCIDSFRYHVGGDRYRDEDLAGWLRRTVLRPLTTLRAMYKLAVEVQSLKARALMVSERRLRYKLEPPAAASSSGEYAPRCYDDLDRRLPALSVDESRRRPQQDQSRPQAAGHGRRRRRLGPPEGGVHRRLRRPRQDDAGGDGVQEPRGAGHPAQGIRDGDPELQPSSSAGIVGGAALRANARFTLLHEEDDHGSRRILRGIETKDIPQLLAHCSTHLRDKRYFVVVDDVWSLEDWASLKPAFPDNDIHSRVVITTRNRQVAESCCSLPVDRVYSMDVLQDDQSRKLFFNTVFRSNKCPAGYRRLETISGNILAKCGGLPLAIVSVGGMLAQAENKTPAEWMKVCDRLGSRLSTSAMMERMRRIMSLSYHDLLYHLKACFLYLSVFREGYEIKRGPLVRRWAAEGFVGGRRECTPEEAAGKYLDEFVGRSIVTPTRVVSNGVVRCCKVHDIMLEMMTEKCMEENFISLLGSPSKHGHQQHAMMVAAGHDKIRRLSVHGAHTSQGKQAGGVHDKHLCRRRIKKDEEQDDVLSSGDLSCVRSLLMLRCIEKPIPVISFAKLKLIRVLDLEGCRWLSNHDLEDICKLSLLRYLSLRDTGVQRLPRLIGRLKELLTLDIRETDVRALPETITRLGRLRHLLAGRYRYYTRSHRVKLFEPFEAVTIPPGLAAMGSLQTIAHANIASSSIAMGELGDLPGLTKLCVMNCEEGPSKWEPFVISLNKLSYSLRSLSILHWQYDNAGLEALLDLTSPPIFLEKFFLWGKLSTLPSWVSHLSNLVDLCLRENFLNGEVIIEQLGKLPSLLSLKLYRASYLGRELRFREKLFPRLKQLIVDNLPNIEELSFQGGAPQLERLTLAVLKKPEDGIFGIDKLPMLKEVEFYGHIMIDSVVAEMVAVCRNHPNKPRVYREDRPMEMDSESSN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF126
9-995 PTHR23155:SF126,NBS-LRR DISEASE RESISTANCE PROTEIN-LIKE (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01

TEGVVHILLGKLGEFLSDKYVLLSGVRHEIQELKDDLESMNACLRDLAAAGDYHQTQQTRTWMKQVREVAYDAEDCIDSFRYHVGGDRYRDEDLAGWLRRTVLRPLTTLRAMYKLAVEVQSLKARALMVSERRLRYKLEPPAAASSSGEYAPRCYDDLDRRLPALSVDESRRRPQQDQSRPQAAGHGRRRRRLGPPEGGVHRRLRRPRQDDAGGDGVQEPRGAGHPAQGIRDGDPELQPSSSAGIVGGAALRANARFTLLHEEDDHGSRRILRGIETKDIPQLLAHCSTHLRDKRYFVVVDDVWSLEDWASLKPAFPDNDIHSRVVITTRNRQVAESCCSLPVDRVYSMDVLQDDQSRKLFFNTVFRSNKCPAGYRRLETISGNILAKCGGLPLAIVSVGGMLAQAENKTPAEWMKVCDRLGSRLSTSAMMERMRRIMSLSYHDLLYHLKACFLYLSVFREGYEIKRGPLVRRWAAEGFVGGRRECTPEEAAGKYLDEFVGRSIVTPTRVVSNGVVRCCKVHDIMLEMMTEKCMEENFISLLGSPSKHGHQQHAMMVAAGHDKIRRLSVHGAHTSQGKQAGGVHDKHLCRRRIKKDEEQDDVLSSGDLSCVRSLLMLRCIEKPIPVISFAKLKLIRVLDLEGCRWLSNHDLEDICKLSLLRYLSLRDTGVQRLPRLIGRLKELLTLDIRETDVRALPETITRLGRLRHLLAGRYRYYTRSHRVKLFEPFEAVTIPPGLAAMGSLQTIAHANIASSSIAMGELGDLPGLTKLCVMNCEEGPSKWEPFVISLNKLSYSLRSLSILHWQYDNAGLEALLDLTSPPIFLEKFFLWGKLSTLPSWVSHLSNLVDLCLRENFLNGEVIIEQLGKLPSLLSLKLYRASYLGRELRFREKLFPRLKQLIVDNLPNIEELSFQGGAPQLERLTLAVLKKPEDGIFGIDKLPMLKEVEFYGHIMIDSVVAEMVAVCRNHPNKPRVYREDRPMEMDSE

HMMPanther: PTHR23155
9-995 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TEGVVHILLGKLGEFLSDKYVLLSGVRHEIQELKDDLESMNACLRDLAAAGDYHQTQQTRTWMKQVREVAYDAEDCIDSFRYHVGGDRYRDEDLAGWLRRTVLRPLTTLRAMYKLAVEVQSLKARALMVSERRLRYKLEPPAAASSSGEYAPRCYDDLDRRLPALSVDESRRRPQQDQSRPQAAGHGRRRRRLGPPEGGVHRRLRRPRQDDAGGDGVQEPRGAGHPAQGIRDGDPELQPSSSAGIVGGAALRANARFTLLHEEDDHGSRRILRGIETKDIPQLLAHCSTHLRDKRYFVVVDDVWSLEDWASLKPAFPDNDIHSRVVITTRNRQVAESCCSLPVDRVYSMDVLQDDQSRKLFFNTVFRSNKCPAGYRRLETISGNILAKCGGLPLAIVSVGGMLAQAENKTPAEWMKVCDRLGSRLSTSAMMERMRRIMSLSYHDLLYHLKACFLYLSVFREGYEIKRGPLVRRWAAEGFVGGRRECTPEEAAGKYLDEFVGRSIVTPTRVVSNGVVRCCKVHDIMLEMMTEKCMEENFISLLGSPSKHGHQQHAMMVAAGHDKIRRLSVHGAHTSQGKQAGGVHDKHLCRRRIKKDEEQDDVLSSGDLSCVRSLLMLRCIEKPIPVISFAKLKLIRVLDLEGCRWLSNHDLEDICKLSLLRYLSLRDTGVQRLPRLIGRLKELLTLDIRETDVRALPETITRLGRLRHLLAGRYRYYTRSHRVKLFEPFEAVTIPPGLAAMGSLQTIAHANIASSSIAMGELGDLPGLTKLCVMNCEEGPSKWEPFVISLNKLSYSLRSLSILHWQYDNAGLEALLDLTSPPIFLEKFFLWGKLSTLPSWVSHLSNLVDLCLRENFLNGEVIIEQLGKLPSLLSLKLYRASYLGRELRFREKLFPRLKQLIVDNLPNIEELSFQGGAPQLERLTLAVLKKPEDGIFGIDKLPMLKEVEFYGHIMIDSVVAEMVAVCRNHPNKPRVYREDRPMEMDSE

HMMPfam: PF00931
IPR002182
286-489 NB-ARC,NBS
NB-ARC

KDIPQLLAHCSTHLRDKRYFVVVDDVWSLEDWASLKPAFPDNDIHSRVVITTRNRQVAESCCSLPVDRVYSMDVLQDDQSRKLFFNTVFRSNKCPAGYRRLETISGNILAKCGGLPLAIVSVGGMLAQAENKTPAEWMKVCDRLGSRLSTSAMMERMRRIMSLSYHDLLYHLKACFLYLSVFREGYEIKRGPLVRRWAAEGFVG

FPrintScan: PR00364
IPR000767
298-312 DISEASERSIST
Disease resistance protein

HLRDKRYFVVVDDVW

superfamily: SSF52540
298-437 SSF52540

HLRDKRYFVVVDDVWSLEDWASLKPAFPDNDIHSRVVITTRNRQVAESCCSLPVDRVYSMDVLQDDQSRKLFFNTVFRSNKCPAGYRRLETISGNILAKCGGLPLAIVSVGGMLAQAENKTPAEWMKVCDRLGSRLSTSA

FPrintScan: PR00364
IPR000767
397-411 DISEASERSIST
Disease resistance protein

CGGLPLAIVSVGGML

superfamily: SSF52047
616-936 SSF52047,LRR

LSCVRSLLMLRCIEKPIPVISFAKLKLIRVLDLEGCRWLSNHDLEDICKLSLLRYLSLRDTGVQRLPRLIGRLKELLTLDIRETDVRALPETITRLGRLRHLLAGRYRYYTRSHRVKLFEPFEAVTIPPGLAAMGSLQTIAHANIASSSIAMGELGDLPGLTKLCVMNCEEGPSKWEPFVISLNKLSYSLRSLSILHWQYDNAGLEALLDLTSPPIFLEKFFLWGKLSTLPSWVSHLSNLVDLCLRENFLNGEVIIEQLGKLPSLLSLKLYRASYLGRELRFREKLFPRLKQLIVDNLPNIEELSFQGGAPQLERLTLAVL

Gene3D: G3DSA:3.80.10.10
628-775 G3DSA:3.80.10.10

IEKPIPVISFAKLKLIRVLDLEGCRWLSNHDLEDICKLSLLRYLSLRDTGVQRLPRLIGRLKELLTLDIRETDVRALPETITRLGRLRHLLAGRYRYYTRSHRVKLFEPFEAVTIPPGLAAMGSLQTIAHANIASSSIAMGELGDLPG

FPrintScan: PR00364
IPR000767
638-654 DISEASERSIST
Disease resistance protein

AKLKLIRVLDLEGCRWL

Gene3D: G3DSA:3.80.10.10
776-974 G3DSA:3.80.10.10

LTKLCVMNCEEGPSKWEPFVISLNKLSYSLRSLSILHWQYDNAGLEALLDLTSPPIFLEKFFLWGKLSTLPSWVSHLSNLVDLCLRENFLNGEVIIEQLGKLPSLLSLKLYRASYLGRELRFREKLFPRLKQLIVDNLPNIEELSFQGGAPQLERLTLAVLKKPEDGIFGIDKLPMLKEVEFYGHIMIDSVVAEMVAVC


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox