PRGDB00048183 (B1189A09.50)

From PRG Wiki
Jump to: navigation, search
B1189A09.50
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21327966 (AP003209)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1189A09.

DNA Sequence

ATGGCATCCACACTACCACAGCTTCTCCTCATACTGCTGCTACTCACATTGTACTGCTCCATCCAAACTGTTGCCAACACCACCATCCCAGTTCATTGCCATCCTCACCAAGCTGAAGCGCTTCTCCAGCTGAAGAGCTCCTTCATTAATCCAAACCTCTCGTCATGGAAACTGAACACCGACTGTTGCCACTGGGAGGGTGTCACCTGCGACACATCCTCTGGGCAGGTAACAGCGTTGGACCTCAGTTACTATAATCTCCAGAGCCCCGGTGGCCTAGACCCAGCGGTCTTCAACCTCACCACTCTGAGAAACCTCAGCCTTGCTGGTAACGATTTCAACCGGACCGTTCTTCCTAGTTTCGGGTTTCAGCGGCTCACCAAACTCCTCAGGCTCGATTTGTCAGAAGCAGGCTTCTTTGGTCAGATACCCATTGGAATTGCACATCTCAAGAATTTGCGTGCTCTTGATCTTTCCTTCAATTATCTGTTTTTTCAAGAACCGAGTTTTCAAACCATTGTAGCAAACCTGAGCAATTTGAGAGAGCTCTATCTTGATCAAGTGCGCATTACTAGTGAACCAACCTGGTCCGTTGCTTTAGCACACTCTCTCCCTCTGCTGCAGAATCTTAGTTTGTCCCAATGTGACCTAGGTGGAACTATTCATCGTTCATTTTCCCAACTCCGCTCTCTAGTGGTGATCAACCTCAACTACAATGGAATTTCTGGAAGGGTTCCTGAGTTCTTTGCAGACTTCTTTTTCTTGAGTGACCTTGCTCTCTCGAACAATAATTTTGAAGGGCAATTTCCCACAAAGATATTCCAGGTAGAAAATTTGAGGTCTCTTGATGTATCTTTCAATCCTACTCTTTTTGTCCAACTTCCGGATTTCCCACCTGGAAAATATTTGGAATCACTAAATCTTCAGAGGACAAACTTTTCTGGTAACATGCCAGCCTCGTTTATCCACCTCAAATCATTGAAATTTTTGGGCCTTAGCAACGTAGGATCTCCCAAGCAGGTTGCTACTTTCATACCTAGCCTTCCATCTCTAGATACATTATGGCTCTCTGGATCAGGCATAGAGAAGCCACTGTTATCTTGGATTGGAACAATTAAACTGAGAGACTTGATGCTCGAAGGCTATAATTTCTCCAGTCCAATACCCCCTTGGATCAGAAACTGTACAAGTTTGGAATCTTTAGTGCTCTTTAATTGCAGCTTCTATGGGCCAATACCATCATGGATTGGGAACTTGACTAAGCTTATCTATTTGGAACTTTCACTTAACAGCCTCAGCGGTAGAATCCCGAAGCTTCTTTTCGCTCATCAATCGTTGGAAATGCTAGATCTGCGATCAAACCAACTTTCTGGACATCTAGAAGACATTTCAGACCCGTTTTCCTCGTTGTTAGAATTCATCGACTTAAGCTATAACCACCTTACAGGCTACATACCCAAATCGTTCTTTGATCTTAGAAGACTAACAAATCTCGTGCTTCAATCAAATCAATTGAATGGTACACTGGAAATTAACCTTCTTTGGAAGATGGAGAAACTAGAATCATTAATTATCTCTAACAATATGTTGTCGGTGATAGATCGAGAAGATGGCTATCCATTTCATTACTTCCCTACAATCAAATACCTGGGACTAGCATCTTGCAACCTTACAAAAATTCCAGGCGCATTGAGAGATATAAAAGGTATGTCTTACTTGGACCTTTCAAACAACAGAATAAATGGAGTAATACCAAGCTGGATATGGGATAACTGGAAGAATAGCTTGTCCGTGTTAGTACTCTCTAACAACATGTTCACTAGCTTGGAAAATAATCCATCTGTTCTTCCCTTGCACACTTTAGATAGACTCAATCTTAGTTCCAACAGACTGCATGGTAACGTACCTATACCACTGACAACTACTAGAGATGGTGGTGTTCTCTTGGATTACTCTAGCAACAGCTTCTCTTCAATTACTCGTGACTTCGGCAGGTATCTTCGAAACGTCTACTATCTTAGCTTTTCCAGGAATAAAATAAGTGGTCATATACCAAGTTCTATATGTACCCAATGTTATCTTGAGGTCCTTGACTTATCACACAACAACTTCAGTGGTATGGTGCCATCCTGTTTAATACAAAATGGTGATGTCACCATATTGAAGTTAAGGGAGAACAACTTCCATGGCGTGCTGCCTAAGAATATTAGAGAAGGATGTATGTTTCAGACAATCGATCTGAACAGCAACCGAATTATAGGGAAACTGCCTAGATCATTGTCTAAATGCAAGAGCTTAGAGGTTCTTGACATGGGTAACAACCAGATTCTTGATTCTTTCCCATCTTGGTTAGGGAACATGTCCAATCTTCGGGTTCTCATCTTGAGATCCAATCAATTCTATGGTTCAGTAGGACTACCTACAGAAAGTGATGCAACCAGTAAGTATTTCTCAGGTTTGCAAATTATTGATTTAGCCTCAAATAACTTATCAGGGAGTTTGCAATCAAAATGGTTTGAGAACCTTGAAACAATGATGATAAATAGTGATCAGGGTGATGTTTTGGGCATTCAGGGGATATATAAGGGCTTATACCAAAACAATATGATTGTTACATTTAAAGGGTTTGATCTCATGTTTACCAAAATCCTGACTACTTTCAAGATGATAGACTTATCAAACAATGATTTCAATGGTGCTATCCCAGAATCAATTGGGAAGCTAATTGCTCTACATGGTTTGAACATGTCACGCAACTCCTTCACTGGAAGAATTCCATCTAAGATTGGTAAATTGGTTCAGCTCGAGTCCTTGGACCTCTCTTTGAATCAGCTCTCAGAAGCAATCCCACAGGAGTTGGCATCCCTAACATCTCTCGCAATATTGAATCTCTCATACAACAATTTGACTGGACAGATACCACAAGGGCCACAGTTCTTGTCATTCGGCAACAGATCATTCGAAGGCAATGCAGGACTCTGTGGAAGGCCGCTGTCCAAACAGTGCAACTATTCAGGCATAGAAGCTGCAAGATCACCATCATCCTCTCGAGATAGTGTGGGGATAATAATATTGTTTGTGTTTGTGGGATCCGGCTTCAAGACCAATGATTTATCGGTGCAGGAACACATGCTTGATTTGCAAAGCTAG


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein putative verticillium wilt disease resistance protein [Oryza sativa Japonica Group].

MASTLPQLLLILLLLTLYCSIQTVANTTIPVHCHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTLFVQLPDFPPGKYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSSLLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFTSLENNPSVLPLHTLDRLNLSSNRLHGNVPIPLTTTRDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNIREGCMFQTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMINSDQGDVLGIQGIYKGLYQNNMIVTFKGFDLMFTKILTTFKMIDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGNAGLCGRPLSKQCNYSGIEAARSPSSSRDSVGIIILFVFVGSGFKTNDLSVQEHMLDLQS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF905
9-990 PTHR24420:SF905

LLILLLLTLYCSIQTVANTTIPVHCHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTLFVQLPDFPPGKYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSSLLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFTSLENNPSVLPLHTLDRLNLSSNRLHGNVPIPLTTTRDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNIREGCMFQTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMINSDQGDVLGIQGIYKGLYQNNMIVTFKGFDLMFTKILTTFKMIDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGN

HMMPanther: PTHR24420
9-990 PTHR24420,FAMILY NOT NAMED

LLILLLLTLYCSIQTVANTTIPVHCHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTLFVQLPDFPPGKYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSSLLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFTSLENNPSVLPLHTLDRLNLSSNRLHGNVPIPLTTTRDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNIREGCMFQTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMINSDQGDVLGIQGIYKGLYQNNMIVTFKGFDLMFTKILTTFKMIDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGN

superfamily: SSF52058
31-334 SSF52058,LRR

VHCHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTLFVQLPDFPPGKYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSN

Gene3D: G3DSA:3.80.10.10
33-290 G3DSA:3.80.10.10

CHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTL

HMMPfam: PF08263
IPR013210
35-71 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCD

Gene3D: G3DSA:3.80.10.10
301-469 G3DSA:3.80.10.10

KYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSS

superfamily: SSF52047
305-607 SSF52047,LRR

SLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSSLLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFT

HMMPfam: PF13855
470-530 LRR_8,Leucine rich repeat

LLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNML

Gene3D: G3DSA:3.80.10.10
471-629 G3DSA:3.80.10.10

LEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFTSLENNPSVLPLHTLDRLNLSSN

FPrintScan: PR00019
570-583 LEURICHRPT,Leucine-rich repeat signature

MSYLDLSNNRINGV

HMMPfam: PF00560
IPR001611
572-589 LRR_1
Leucine-rich repeat

YLDLSNNRINGVIPSWIW

Gene3D: G3DSA:3.80.10.10
630-736 G3DSA:3.80.10.10

RLHGNVPIPLTTTRDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNI

superfamily: SSF52058
643-1002 SSF52058,LRR

RDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNIREGCMFQTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMINSDQGDVLGIQGIYKGLYQNNMIVTFKGFDLMFTKILTTFKMIDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGNAGLCGRPLSKQC

HMMPfam: PF00560
IPR001611
694-713 LRR_1
Leucine-rich repeat

LEVLDLSHNNFSGMVPSCLI

Gene3D: G3DSA:3.80.10.10
743-847 G3DSA:3.80.10.10

QTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMI

HMMPfam: PF13855
743-799 LRR_8,Leucine rich repeat

QTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQ

Gene3D: G3DSA:3.80.10.10
890-999 G3DSA:3.80.10.10

IDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGNAGLCGRPLS

HMMPfam: PF12799
934-970 LRR_4,Leucine Rich repeats (2 copies)

QLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLT

FPrintScan: PR00019
956-969 LEURICHRPT,Leucine-rich repeat signature

LTSLAILNLSYNNL


List of References

Takuji Sasaki, Takashi Matsumoto, Kimiko Yamamoto, Katsumi Sakata, Tomoya Baba, Yuichi Katayose, Jianzhong Wu, Yoshihito Niimura, Zhukuan Cheng, Yoshiaki Nagamura, Baltazar A Antonio, Hiroyuki Kanamori, Satomi Hosokawa, Masatoshi Masukawa, Koji Arikawa, Yoshino Chiden, Mika Hayashi, Masako Okamoto, Tsuyu Ando, Hiroyoshi Aoki, Kohei Arita, Masao Hamada, Chizuko Harada, Saori Hijishita, Mikiko Honda, Yoko Ichikawa, Atsuko Idonuma, Masumi Iijima, Michiko Ikeda, Maiko Ikeno, Sachie Ito, Tomoko Ito, Yuichi Ito, Yukiyo Ito, Aki Iwabuchi, Kozue Kamiya, Wataru Karasawa, Satoshi Katagiri, Ari Kikuta, Noriko Kobayashi, Izumi Kono, Kayo Machita, Tomoko Maehara, Hiroshi Mizuno, Tatsumi Mizubayashi, Yoshiyuki Mukai, Hideki Nagasaki, Marina Nakashima, Yuko Nakama, Yumi Nakamichi, Mari Nakamura, Nobukazu Namiki, Manami Negishi, Isamu Ohta, Nozomi Ono, Shoko Saji, Kumiko Sakai, Michie Shibata, Takanori Shimokawa, Ayahiko Shomura, Jianyu Song, Yuka Takazaki, Kimihiro Terasawa, Kumiko Tsuji, Kazunori Waki, Harumi Yamagata, Hiroko Yamane, Shoji Yoshiki, Rie Yoshihara, Kazuko Yukawa, Huisun Zhong, Hisakazu Iwama, Toshinori Endo, Hidetaka Ito, Jang Ho Hahn, Ho-Il Kim, Moo-Young Eun, Masahiro Yano, Jiming Jiang, Takashi Gojobori
The genome sequence and structure of rice chromosome 1.
Nature: 2002, 420(6913);312-6
PubMed:12447438 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox