PRGDB00048183 (B1189A09.50)

From PRG Wiki
Jump to: navigation, search
B1189A09.50
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21327966 (AP003209)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1189A09.

DNA Sequence

ATGGCATCCACACTACCACAGCTTCTCCTCATACTGCTGCTACTCACATTGTACTGCTCCATCCAAACTGTTGCCAACACCACCATCCCAGTTCATTGCCATCCTCACCAAGCTGAAGCGCTTCTCCAGCTGAAGAGCTCCTTCATTAATCCAAACCTCTCGTCATGGAAACTGAACACCGACTGTTGCCACTGGGAGGGTGTCACCTGCGACACATCCTCTGGGCAGGTAACAGCGTTGGACCTCAGTTACTATAATCTCCAGAGCCCCGGTGGCCTAGACCCAGCGGTCTTCAACCTCACCACTCTGAGAAACCTCAGCCTTGCTGGTAACGATTTCAACCGGACCGTTCTTCCTAGTTTCGGGTTTCAGCGGCTCACCAAACTCCTCAGGCTCGATTTGTCAGAAGCAGGCTTCTTTGGTCAGATACCCATTGGAATTGCACATCTCAAGAATTTGCGTGCTCTTGATCTTTCCTTCAATTATCTGTTTTTTCAAGAACCGAGTTTTCAAACCATTGTAGCAAACCTGAGCAATTTGAGAGAGCTCTATCTTGATCAAGTGCGCATTACTAGTGAACCAACCTGGTCCGTTGCTTTAGCACACTCTCTCCCTCTGCTGCAGAATCTTAGTTTGTCCCAATGTGACCTAGGTGGAACTATTCATCGTTCATTTTCCCAACTCCGCTCTCTAGTGGTGATCAACCTCAACTACAATGGAATTTCTGGAAGGGTTCCTGAGTTCTTTGCAGACTTCTTTTTCTTGAGTGACCTTGCTCTCTCGAACAATAATTTTGAAGGGCAATTTCCCACAAAGATATTCCAGGTAGAAAATTTGAGGTCTCTTGATGTATCTTTCAATCCTACTCTTTTTGTCCAACTTCCGGATTTCCCACCTGGAAAATATTTGGAATCACTAAATCTTCAGAGGACAAACTTTTCTGGTAACATGCCAGCCTCGTTTATCCACCTCAAATCATTGAAATTTTTGGGCCTTAGCAACGTAGGATCTCCCAAGCAGGTTGCTACTTTCATACCTAGCCTTCCATCTCTAGATACATTATGGCTCTCTGGATCAGGCATAGAGAAGCCACTGTTATCTTGGATTGGAACAATTAAACTGAGAGACTTGATGCTCGAAGGCTATAATTTCTCCAGTCCAATACCCCCTTGGATCAGAAACTGTACAAGTTTGGAATCTTTAGTGCTCTTTAATTGCAGCTTCTATGGGCCAATACCATCATGGATTGGGAACTTGACTAAGCTTATCTATTTGGAACTTTCACTTAACAGCCTCAGCGGTAGAATCCCGAAGCTTCTTTTCGCTCATCAATCGTTGGAAATGCTAGATCTGCGATCAAACCAACTTTCTGGACATCTAGAAGACATTTCAGACCCGTTTTCCTCGTTGTTAGAATTCATCGACTTAAGCTATAACCACCTTACAGGCTACATACCCAAATCGTTCTTTGATCTTAGAAGACTAACAAATCTCGTGCTTCAATCAAATCAATTGAATGGTACACTGGAAATTAACCTTCTTTGGAAGATGGAGAAACTAGAATCATTAATTATCTCTAACAATATGTTGTCGGTGATAGATCGAGAAGATGGCTATCCATTTCATTACTTCCCTACAATCAAATACCTGGGACTAGCATCTTGCAACCTTACAAAAATTCCAGGCGCATTGAGAGATATAAAAGGTATGTCTTACTTGGACCTTTCAAACAACAGAATAAATGGAGTAATACCAAGCTGGATATGGGATAACTGGAAGAATAGCTTGTCCGTGTTAGTACTCTCTAACAACATGTTCACTAGCTTGGAAAATAATCCATCTGTTCTTCCCTTGCACACTTTAGATAGACTCAATCTTAGTTCCAACAGACTGCATGGTAACGTACCTATACCACTGACAACTACTAGAGATGGTGGTGTTCTCTTGGATTACTCTAGCAACAGCTTCTCTTCAATTACTCGTGACTTCGGCAGGTATCTTCGAAACGTCTACTATCTTAGCTTTTCCAGGAATAAAATAAGTGGTCATATACCAAGTTCTATATGTACCCAATGTTATCTTGAGGTCCTTGACTTATCACACAACAACTTCAGTGGTATGGTGCCATCCTGTTTAATACAAAATGGTGATGTCACCATATTGAAGTTAAGGGAGAACAACTTCCATGGCGTGCTGCCTAAGAATATTAGAGAAGGATGTATGTTTCAGACAATCGATCTGAACAGCAACCGAATTATAGGGAAACTGCCTAGATCATTGTCTAAATGCAAGAGCTTAGAGGTTCTTGACATGGGTAACAACCAGATTCTTGATTCTTTCCCATCTTGGTTAGGGAACATGTCCAATCTTCGGGTTCTCATCTTGAGATCCAATCAATTCTATGGTTCAGTAGGACTACCTACAGAAAGTGATGCAACCAGTAAGTATTTCTCAGGTTTGCAAATTATTGATTTAGCCTCAAATAACTTATCAGGGAGTTTGCAATCAAAATGGTTTGAGAACCTTGAAACAATGATGATAAATAGTGATCAGGGTGATGTTTTGGGCATTCAGGGGATATATAAGGGCTTATACCAAAACAATATGATTGTTACATTTAAAGGGTTTGATCTCATGTTTACCAAAATCCTGACTACTTTCAAGATGATAGACTTATCAAACAATGATTTCAATGGTGCTATCCCAGAATCAATTGGGAAGCTAATTGCTCTACATGGTTTGAACATGTCACGCAACTCCTTCACTGGAAGAATTCCATCTAAGATTGGTAAATTGGTTCAGCTCGAGTCCTTGGACCTCTCTTTGAATCAGCTCTCAGAAGCAATCCCACAGGAGTTGGCATCCCTAACATCTCTCGCAATATTGAATCTCTCATACAACAATTTGACTGGACAGATACCACAAGGGCCACAGTTCTTGTCATTCGGCAACAGATCATTCGAAGGCAATGCAGGACTCTGTGGAAGGCCGCTGTCCAAACAGTGCAACTATTCAGGCATAGAAGCTGCAAGATCACCATCATCCTCTCGAGATAGTGTGGGGATAATAATATTGTTTGTGTTTGTGGGATCCGGCTTCAAGACCAATGATTTATCGGTGCAGGAACACATGCTTGATTTGCAAAGCTAG


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein putative verticillium wilt disease resistance protein [Oryza sativa Japonica Group].

MASTLPQLLLILLLLTLYCSIQTVANTTIPVHCHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTLFVQLPDFPPGKYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSSLLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFTSLENNPSVLPLHTLDRLNLSSNRLHGNVPIPLTTTRDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNIREGCMFQTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMINSDQGDVLGIQGIYKGLYQNNMIVTFKGFDLMFTKILTTFKMIDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGNAGLCGRPLSKQCNYSGIEAARSPSSSRDSVGIIILFVFVGSGFKTNDLSVQEHMLDLQS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF905
9-990 PTHR24420:SF905

LLILLLLTLYCSIQTVANTTIPVHCHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTLFVQLPDFPPGKYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSSLLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFTSLENNPSVLPLHTLDRLNLSSNRLHGNVPIPLTTTRDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNIREGCMFQTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMINSDQGDVLGIQGIYKGLYQNNMIVTFKGFDLMFTKILTTFKMIDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGN

HMMPanther: PTHR24420
9-990 PTHR24420,FAMILY NOT NAMED

LLILLLLTLYCSIQTVANTTIPVHCHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTLFVQLPDFPPGKYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSSLLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFTSLENNPSVLPLHTLDRLNLSSNRLHGNVPIPLTTTRDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNIREGCMFQTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMINSDQGDVLGIQGIYKGLYQNNMIVTFKGFDLMFTKILTTFKMIDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGN

superfamily: SSF52058
31-334 SSF52058,LRR

VHCHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTLFVQLPDFPPGKYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSN

Gene3D: G3DSA:3.80.10.10
33-290 G3DSA:3.80.10.10

CHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSGQVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHLKNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSFSQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTL

HMMPfam: PF08263
IPR013210
35-71 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCD

Gene3D: G3DSA:3.80.10.10
301-469 G3DSA:3.80.10.10

KYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSS

superfamily: SSF52047
305-607 SSF52047,LRR

SLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLRDLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLDLRSNQLSGHLEDISDPFSSLLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFT

HMMPfam: PF13855
470-530 LRR_8,Leucine rich repeat

LLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNML

Gene3D: G3DSA:3.80.10.10
471-629 G3DSA:3.80.10.10

LEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNGTLEINLLWKMEKLESLIISNNMLSVIDREDGYPFHYFPTIKYLGLASCNLTKIPGALRDIKGMSYLDLSNNRINGVIPSWIWDNWKNSLSVLVLSNNMFTSLENNPSVLPLHTLDRLNLSSN

FPrintScan: PR00019
570-583 LEURICHRPT,Leucine-rich repeat signature

MSYLDLSNNRINGV

HMMPfam: PF00560
IPR001611
572-589 LRR_1
Leucine-rich repeat

YLDLSNNRINGVIPSWIW

Gene3D: G3DSA:3.80.10.10
630-736 G3DSA:3.80.10.10

RLHGNVPIPLTTTRDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNI

superfamily: SSF52058
643-1002 SSF52058,LRR

RDGGVLLDYSSNSFSSITRDFGRYLRNVYYLSFSRNKISGHIPSSICTQCYLEVLDLSHNNFSGMVPSCLIQNGDVTILKLRENNFHGVLPKNIREGCMFQTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMINSDQGDVLGIQGIYKGLYQNNMIVTFKGFDLMFTKILTTFKMIDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGNAGLCGRPLSKQC

HMMPfam: PF00560
IPR001611
694-713 LRR_1
Leucine-rich repeat

LEVLDLSHNNFSGMVPSCLI

Gene3D: G3DSA:3.80.10.10
743-847 G3DSA:3.80.10.10

QTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMI

HMMPfam: PF13855
743-799 LRR_8,Leucine rich repeat

QTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLILRSNQ

Gene3D: G3DSA:3.80.10.10
890-999 G3DSA:3.80.10.10

IDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGNAGLCGRPLS

HMMPfam: PF12799
934-970 LRR_4,Leucine Rich repeats (2 copies)

QLESLDLSLNQLSEAIPQELASLTSLAILNLSYNNLT

FPrintScan: PR00019
956-969 LEURICHRPT,Leucine-rich repeat signature

LTSLAILNLSYNNL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox