PRGDB00048184 (OSJNBb0035K09.37)

From PRG Wiki
Jump to: navigation, search
OSJNBb0035K09.37
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 55296719 (AP007273)
Gene Class RLP
Domain Type LRR, LRR, LRR, LRR, LRR, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBb0035K09.

DNA Sequence

ATGTCTTCCTTGGGTTTCTCCTCTCCTGGCTTTCTTCAGCTTCTTTATATCTTGAAATTCTTTTGCCTCCTACCGCTAGTCATCGGTAGCAACGAAACCGAAAGTGATCGACAAGCTCTCCTTTGCTTAAAGTCCCAGCTCACTGGTTCAGCTGAAGTTTTGTCCTCATGGAGCAATGCATCTATGGAATTCTGCAGCTGGCATGGGGTCACTTGCAGTACACAATATCCACGCCGTGTCACTGCTCTTGATCTCTCATCAGAAGGAATCACAGGCTCCATATCACCTTGTATTGCCAACCTCACTTATCTTACAAAGCTCCAACTGTCAAATAATAGCTTTTATGGCAGCATACCATCCGAGCTCGGCTTCCTAACTCAACTCAGCATCCTCAACATTAGCATGAACTCTTTAGAAGGTAACATTCCATCTGAACTCACTTCATGTTTCAAGCTTCAAAAGATCGACCTTAGCAACAACAAACTCCAAGGGAGCATACCTTCTGCTTTTGGGGATCTTACTGAGCTTCGAACACTTATACTCACTAGCAACAGGCTTTCTGGTGACATACCACAATCATTGGGAAGCAACCTTTCACTAACTTATGTCGATCTTGGGAGGAATGCTCTCGCAGGGAGAATTCCACAATCATTGGCAAGCAGTACATCTTTGCAGTTTCTTATTCTCACGAGCAATACCCTTAGTGGAGAACTCCCAAAGGCTCTCTTAAACAGTTCATCGCTTATTTTTCTTGACCTCCAACAGAATAACTTTGTTGGTTCTATACCACCTGTTACGGCAATATCGCCGAAAATGTACTATCTTGATTTAAGATTCAACCATCTCACAGGAACAATACCTTCCTCACTTGGAAATCTTTCCTCCCTAACTTATCTTTGTCTTATAGGGAACAATTTAGTTGGGAGCATCCCAGATACCCTAGGCCATGTTCCAACACTAGAGACACTGGCAGTTAATGTAAACAACTTGTCAGGGCCAGTTCCGCCATCTATCTTCAACGTAACATCACTGACATATCTTGGAATGGCAAACAACTCTCTCACTGGAAGATTACCCTCAAACATTGGCTACACGCTCCCAAATATTCAGCAATTAATCCTCCCGAATAATAAATTCAGTGGCTCAATCCCGAGTTCGCTTCTTAATGCATCCCACCTGCAGAGACTTTTCCTTACTAATAACAGCTTCACTGGGCATATACCATTCTTTGGATCATTGCAGAATTTGGAGATCCTTGACATGGCATACAACATGCTAGAAGCAGGTGACTGGAGCTTTGTCTCGTCACTCACAAATTGCTCCAAATTGACTCAACTGCTTCTGGATGGGAATAATCTTCAAGGGAACCTACCAAGTTGTATTGGTAACCTGTCTAGTAGTCTTGAGCACTTGTGGCTAAGAAATAACATGATTTCTGGGCTTATACCACCAGGGATTGGCAACCTTAAGAGTTTGAATACGTTGTACATGGATGACAATTATTTAACCGGCAATATACCACCCACAATTGGATATTTACACAACATGAATAAGTTGTACATGGATTACAATTATTTAACCGGCAATATACCACCTACAATTGGATATTTACACAGCATGGTCTTCCTGTCCTTTTCACACAACAGACTCTCTGGGCAAATCCCTGGCACTATAGGCAACCTTGTTCAACTGAATGAACTGCGTCTTGATGAGAATAACTTGAGTGGAAGCATACCTGCGAGTATACGTCACTGCACTCAACTCACAAAACTCAACCTTGCTCACAACTCACTTCATGGGACCACTATTGCATCTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein Cf-2.1 putative disease resistance protein Cf-2.1 [Oryza sativa Japonica Group].

MSSLGFSSPGFLQLLYILKFFCLLPLVIGSNETESDRQALLCLKSQLTGSAEVLSSWSNASMEFCSWHGVTCSTQYPRRVTALDLSSEGITGSISPCIANLTYLTKLQLSNNSFYGSIPSELGFLTQLSILNISMNSLEGNIPSELTSCFKLQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRLSGDIPQSLGSNLSLTYVDLGRNALAGRIPQSLASSTSLQFLILTSNTLSGELPKALLNSSSLIFLDLQQNNFVGSIPPVTAISPKMYYLDLRFNHLTGTIPSSLGNLSSLTYLCLIGNNLVGSIPDTLGHVPTLETLAVNVNNLSGPVPPSIFNVTSLTYLGMANNSLTGRLPSNIGYTLPNIQQLILPNNKFSGSIPSSLLNASHLQRLFLTNNSFTGHIPFFGSLQNLEILDMAYNMLEAGDWSFVSSLTNCSKLTQLLLDGNNLQGNLPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKSLNTLYMDDNYLTGNIPPTIGYLHNMNKLYMDYNYLTGNIPPTIGYLHSMVFLSFSHNRLSGQIPGTIGNLVQLNELRLDENNLSGSIPASIRHCTQLTKLNLAHNSLHGTTIAS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF686
1-600 OS06G0585900 PROTEIN

MSSLGFSSPGFLQLLYILKFFCLLPLVIGSNETESDRQALLCLKSQLTGSAEVLSSWSNASMEFCSWHGVTCSTQYPRRVTALDLSSEGITGSISPCIANLTYLTKLQLSNNSFYGSIPSELGFLTQLSILNISMNSLEGNIPSELTSCFKLQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRLSGDIPQSLGSNLSLTYVDLGRNALAGRIPQSLASSTSLQFLILTSNTLSGELPKALLNSSSLIFLDLQQNNFVGSIPPVTAISPKMYYLDLRFNHLTGTIPSSLGNLSSLTYLCLIGNNLVGSIPDTLGHVPTLETLAVNVNNLSGPVPPSIFNVTSLTYLGMANNSLTGRLPSNIGYTLPNIQQLILPNNKFSGSIPSSLLNASHLQRLFLTNNSFTGHIPFFGSLQNLEILDMAYNMLEAGDWSFVSSLTNCSKLTQLLLDGNNLQGNLPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKSLNTLYMDDNYLTGNIPPTIGYLHNMNKLYMDYNYLTGNIPPTIGYLHSMVFLSFSHNRLSGQIPGTIGNLVQLNELRLDENNLSGSIPASIRHCTQLTKLNLAHNSLHG

HMMPanther: PTHR24420
1-600 FAMILY NOT NAMED,FAMILY NOT NAMED

MSSLGFSSPGFLQLLYILKFFCLLPLVIGSNETESDRQALLCLKSQLTGSAEVLSSWSNASMEFCSWHGVTCSTQYPRRVTALDLSSEGITGSISPCIANLTYLTKLQLSNNSFYGSIPSELGFLTQLSILNISMNSLEGNIPSELTSCFKLQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRLSGDIPQSLGSNLSLTYVDLGRNALAGRIPQSLASSTSLQFLILTSNTLSGELPKALLNSSSLIFLDLQQNNFVGSIPPVTAISPKMYYLDLRFNHLTGTIPSSLGNLSSLTYLCLIGNNLVGSIPDTLGHVPTLETLAVNVNNLSGPVPPSIFNVTSLTYLGMANNSLTGRLPSNIGYTLPNIQQLILPNNKFSGSIPSSLLNASHLQRLFLTNNSFTGHIPFFGSLQNLEILDMAYNMLEAGDWSFVSSLTNCSKLTQLLLDGNNLQGNLPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKSLNTLYMDDNYLTGNIPPTIGYLHNMNKLYMDYNYLTGNIPPTIGYLHSMVFLSFSHNRLSGQIPGTIGNLVQLNELRLDENNLSGSIPASIRHCTQLTKLNLAHNSLHG

Gene3D: G3DSA:3.80.10.10
32-274 no description

ETESDRQALLCLKSQLTGSAEVLSSWSNASMEFCSWHGVTCSTQYPRRVTALDLSSEGITGSISPCIANLTYLTKLQLSNNSFYGSIPSELGFLTQLSILNISMNSLEGNIPSELTSCFKLQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRLSGDIPQSLGSNLSLTYVDLGRNALAGRIPQSLASSTSLQFLILTSNTLSGELPKALLNSSSLIFLDLQQNNFVGSIPPVTAISPKMYY

HMMPfam: PF08263
IPR013210
35-73 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SDRQALLCLKSQLTGSAEVLSSWSNASMEFCSWHGVTCS

superfamily: SSF52058
54-359 L domain-like,LRR

LSSWSNASMEFCSWHGVTCSTQYPRRVTALDLSSEGITGSISPCIANLTYLTKLQLSNNSFYGSIPSELGFLTQLSILNISMNSLEGNIPSELTSCFKLQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRLSGDIPQSLGSNLSLTYVDLGRNALAGRIPQSLASSTSLQFLILTSNTLSGELPKALLNSSSLIFLDLQQNNFVGSIPPVTAISPKMYYLDLRFNHLTGTIPSSLGNLSSLTYLCLIGNNLVGSIPDTLGHVPTLETLAVNVNNLSGPVPPSIFNVTSLTYLGMANNSLTGRLP

HMMSmart: SM00369
IPR003591
125-149 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTQLSILNISMNSLEGNIPSELTSC

HMMPfam: PF13855
127-186 LRR_8,Leucine rich repeat

QLSILNISMNSLEGNIPSELTSCFKLQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRL

FPrintScan: PR00019
152-165 LEURICHRPT,Leucine-rich repeat signature

LQKIDLSNNKLQGS

HMMSmart: SM00369
IPR003591
173-197 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTELRTLILTSNRLSGDIPQSLGSN

HMMPfam: PF00560
IPR001611
274-293 LRR_1
Leucine-rich repeat

YLDLRFNHLTGTIPSSLGNL

Gene3D: G3DSA:3.80.10.10
275-451 no description

LDLRFNHLTGTIPSSLGNLSSLTYLCLIGNNLVGSIPDTLGHVPTLETLAVNVNNLSGPVPPSIFNVTSLTYLGMANNSLTGRLPSNIGYTLPNIQQLILPNNKFSGSIPSSLLNASHLQRLFLTNNSFTGHIPFFGSLQNLEILDMAYNMLEAGDWSFVSSLTNCSKLTQLLLDGN

HMMSmart: SM00369
IPR003591
293-317 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLTYLCLIGNNLVGSIPDTLGHV

superfamily: SSF52047
309-598 RNI-like,LRR

SIPDTLGHVPTLETLAVNVNNLSGPVPPSIFNVTSLTYLGMANNSLTGRLPSNIGYTLPNIQQLILPNNKFSGSIPSSLLNASHLQRLFLTNNSFTGHIPFFGSLQNLEILDMAYNMLEAGDWSFVSSLTNCSKLTQLLLDGNNLQGNLPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKSLNTLYMDDNYLTGNIPPTIGYLHNMNKLYMDYNYLTGNIPPTIGYLHSMVFLSFSHNRLSGQIPGTIGNLVQLNELRLDENNLSGSIPASIRHCTQLTKLNLAHNSL

HMMSmart: SM00369
IPR003591
341-365 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

VTSLTYLGMANNSLTGRLPSNIGYT

HMMSmart: SM00369
IPR003591
366-390 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNIQQLILPNNKFSGSIPSSLLNA

HMMPfam: PF00560
IPR001611
392-413 LRR_1
Leucine-rich repeat

HLQRLFLTNNSFTGHIPFFGSL

FPrintScan: PR00019
413-426 LEURICHRPT,Leucine-rich repeat signature

LQNLEILDMAYNML

Seg: seg
443-457 seg

LTQLLLDGNNLQGNL

Gene3D: G3DSA:3.80.10.10
452-600 no description

NLQGNLPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKSLNTLYMDDNYLTGNIPPTIGYLHNMNKLYMDYNYLTGNIPPTIGYLHSMVFLSFSHNRLSGQIPGTIGNLVQLNELRLDENNLSGSIPASIRHCTQLTKLNLAHNSLHG

HMMPfam: PF12799
467-506 LRR_4,Leucine Rich repeats (2 copies)

SLEHLWLRNNMISGLIPPGIGNLKSLNTLYMDDNYLTGNI

HMMSmart: SM00369
IPR003591
489-513 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLNTLYMDDNYLTGNIPPTIGYL

HMMSmart: SM00369
IPR003591
561-585 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVQLNELRLDENNLSGSIPASIRHC

HMMPfam: PF13504
586-599 LRR_7,Leucine rich repeat

TQLTKLNLAHNSLH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox