PRGDB00048193 (P0406H10.33)

From PRG Wiki
Jump to: navigation, search
P0406H10.33
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12082348 (AP002524)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0406H10.

DNA Sequence

ATGGATTCAGGGATTATTGGGAGCACAATTGGGATATTCATGCAAGTAATCTTCGACAAGTACCTAAGCTCCAAGTTAGAGCAGTGGGCAGATCGTGCAAACTTAGGAGGTGAATTTCAAAACCTCTGTCGTCAGCTTGATATGGCTAAGGCAATACTTATGACCCTGAAAGGCAGTCCTGTGATGGAGGAGGGCATCTGGCAACTAGTTTGGGATTTGAAGTCTTCAGCTTATGATGCAGAGGATGTGCTTGATGAGTTAGACTACTTTCGCCTTATGGAAATAGTGGACAACAGAAGCGAAAACAAGCTTGCTGCTAGCATTGGATTATCAATTCCTAAAGCTCTTCGGAACACTTTTGACCAGCCAGGTACTCATCTTCCGAGAACTTTTGACTCCACTAAACTTAGATGTTCCTCCCTTTTCCCTCCATTCAAAAAAGCCAGACCAACCTTTGATTATGTGTCATGTGACTGGGATTCAGTCTCTTGCAAGATGAAATCCATTTCCGATCGTCTACAAAGAGCTACCGCCCATATTGAGCGTGTTGCTCAGTTCAAGAAGTTGGTAGCTGATGATATGCAGCAACCAAAGTTTCCAAACTCAAGACAAACCAGCTCACTCTTGACTGAACCAGAGGTGTACGGCAGAGATGAGGAGAAGAACACCATTGTAAAGATACTCCTGGAAACAAAGTTTTCAAATATTCAAAATAGGTACAAGAGCTTCTTGGTGCTCCCAGTTGTAGGCATTGGTGGTGTGGGAAAGACAACCCTTGTGCAGTATGTGTATAATGATCTAGCTACCATCACTTGTTTTGAGGTAAGGGCATGGGCATGTGTGTCTGGATTTCTTGATGTCAAACAGGTAACCATAGACATACTTCAATCAATAGATGAAGAAGGACATAATCAGTTTATCAGTTCGCTCAGTTTAAACAACATTCAGACCATGCTGGTGAAGAAGCTCAAGAAGAGGAAATTCCTAATTGTTCTTGACGATGTGTGGTCCTGCAGTAACTGGGAACTGTTGTGTGCCCCCTTATCATCTGGGACACCAGGGAGCAAAATCATAATCACAACTCGGCATCACAATATAGCTAATACTGTTGGCACAATTCCTTCAGTCATTCTTGGAGGGTTACAAGACAGTCCTTTCTGGTCTTTCTTCAAACAAAACGCATTTGGGGATGCAAATATGGTTGATAATCTGAATTTGATTGGCAGGAAAATAGCAAGCAAGCTGAATGGTATACCTTTGGCTGCAAAGACTATTGGAAAGCTGTTGCACAAGCAACTTACTACAGAGCACTGGATGAGTATATTAGACAGCAACTTATGGGAGCTGAGACAAGGACCTGAAGATATCATGCCAGTCCTTCTCTTGAGCTATCAACACCTGCCTGCAAACATCCAACGTTGCTTTGTATTCTGCTCAGCATTCCCCAAGGACTATTCTTTCTGTGAAGAGGAGCTAATATTTTCCTGGATGGCACATGGTTTTATTCAGTGCATGAGGAGAGACAAAACACTAGAGGATACAGCACGGGAATACCTATACGAATTGGCATCTGCTTCATTCTTCCAAGTTTCATCAAATGACAACCTTTACAGAATGCACGACTTATTGCATGACCTTGCAAGTTCATTATCTAAAGATGAGTGCTTCACTACCAGTGATAATTTGCCTGAAGGTATCCCAGATGTGGTCCGCCACTTGTATTTCCTTTCTCCGGACCATGCTAAATTTTTCCGCCATAAGTTCTCGCTGATCGAGTATGGATCACTGAGCAATGAAAGTTTACCTGAGAGAAGACCACCTGGTCGTCCCCTGGAGTTGAATAATCTAAGGACCATATGGTTTATGGATTCTCCAACAATTTCATTGTCTGATGCATCTGATGATGGATTTTGGAACATGTCTATTAACTACAGAAGAATCATTAATCTCCGCATGCTATGCTTACATCATATAAACTGTGAAGCCCTTCCGGTAACAATTGGTGACTTGATACATTTGAGGTACTTGGATCTCAGGTTCTCAGACATCGCTGAGTTGCCAGAATCAGTACGCAAGCTTTGCCATTTGCAGGTACTGGATGTAAGATCTTGCAAGAACCTTGTTAAATTGCCAACTGGTGTTAACAATCTCATTAGCATTAGACATCTATTAGTTGATGCTTCAAGCAAGTTGCTTGCTGGTTATGCTGGTATTTCTTACATTGGGAAGCTGACCAGCCTACAGGAGTTGGACTGTTTCAATGTTGGAAAGGGAAATGGGTTTAGTATCGAGCAGCTAAAAGAGTTACGGGAGATGGGGCAATCTCTTGCCATTGGGGATCTTGAGAACGTAAGAAACAAGGAAGAAGCAAGTAATTCAGGAGTAAGAGAAAAATACCGCCTGGTTGAGTTAAATTTACTTTGGAATAGCAACTTGAAAAGTAGAAGCAGTGACGTAGAAATAAGTGTTCTTGAGGGTCTTCAACCCCATCCAAATCTCAGACATCTCAGGATAATAAATTATAGAGGCTCTACATCACCAACATGGCTAGCTACGGATTTACATACCAAATACTTGGAGTCCCTCTACCTACATGATTGCTCCGGATGGGAAATGCTTCCTCCTCTTGGACAGCTTCCTTATCTAAGGAGACTTCATTTCACTGGTATGGGTTCCATCCTAAGCATAGGTCCTGAACTCTATGGAAGTGGCTCTTTAATGGGTTTCCCTTGTTTAGAAGAGTTGCATTTTGAGAACATGCTAGAGTGGCGATCATGGTGTGGGGTTGAGAAAGAATGCTTCTTTCCTAAATTGCTGACATTGACCATCATGGACTGTCCCAGCTTGCAGATGCTACCTGTTGAGCAATGGTCTGACCAAGTCAACTACAAATGGTTCCCTTGCCTTGAAATGCTTGACATCCAAAACTGTCCTAGCCTGGATCAATTGCCTCCACTTCCACATTCTTCAACGTTGTCAAGGATAAGTTTGAAAAATGCAGGGATAATCTCTCTCATGGAGTTGAATGATGAAGAGATTGTAATTTCTGGCATATCTGATTTGGTGCTGGAAAGACAATTATTTCTGCCATTTCATAACTTGAGGAGCCTCAAGAGTTTCAGCATACCAGGTTGTGATAATTTCATGGTACTACCATTGAAAGGCCAGGGAAAGCATGATATTTCTGAGGTATCGACGACTATGGATGATTCTGGATCCTCACTGTCTAACATCAGTGAACTCAAGATATGCGGTTCTGGGATATCTGAGGATGTACTACATGAAATTTTATCAAATGTTGGCATTCTTGACTGCTTGTCAATAAAGGACTGCCCCCAGGTTACTTCCCTTGAGCTGAACCCAATGGTAAGACTGGATTACCTGATTATAGAAGATTGCCTAGAGCTCACGACATTGAAATGTATGAAAACTCTCATCCATCTAACAGAACTGACTGTGCTAAGAAGTCCTAAGTTCATGGAGGGATGGAAAAATCTCGTCGAAGAGGCAGAGGGATCACATCTCAGAATTACTGCCTCACTGAAAAGACTGCATATTGATGATTTATCATTCCTTACCATGCCAATTTGTAGGACACTTGGGTATCTTCAATATTTGATGATTGACACGGATCAGCAAACCATATGCCTAACTCCAGAGCAGGAGCAAGCATTTGGTACACTGACTTCATTGAAAACACTCGTGTTCAGTGAATGCTCATATCTCCGCTCATTGCCTGCAACGCTGCACCAGATTTCCTCCCTGAAGAGCCTGCATTTATCATCGTGTGAGAGCATAGACTCCCTACCACACCTGGGATTGCCAGGATCACTGGAAAGGTTGTTCATTGCTGGATGTGACCTGTTGAGAGACAAGTGCGTAGAAGGTGGGATTGACCAGCACAAAATCGCACATGTCAGGGAAACAATTTTGGCATAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa Japonica Group].

MDSGIIGSTIGIFMQVIFDKYLSSKLEQWADRANLGGEFQNLCRQLDMAKAILMTLKGSPVMEEGIWQLVWDLKSSAYDAEDVLDELDYFRLMEIVDNRSENKLAASIGLSIPKALRNTFDQPGTHLPRTFDSTKLRCSSLFPPFKKARPTFDYVSCDWDSVSCKMKSISDRLQRATAHIERVAQFKKLVADDMQQPKFPNSRQTSSLLTEPEVYGRDEEKNTIVKILLETKFSNIQNRYKSFLVLPVVGIGGVGKTTLVQYVYNDLATITCFEVRAWACVSGFLDVKQVTIDILQSIDEEGHNQFISSLSLNNIQTMLVKKLKKRKFLIVLDDVWSCSNWELLCAPLSSGTPGSKIIITTRHHNIANTVGTIPSVILGGLQDSPFWSFFKQNAFGDANMVDNLNLIGRKIASKLNGIPLAAKTIGKLLHKQLTTEHWMSILDSNLWELRQGPEDIMPVLLLSYQHLPANIQRCFVFCSAFPKDYSFCEEELIFSWMAHGFIQCMRRDKTLEDTAREYLYELASASFFQVSSNDNLYRMHDLLHDLASSLSKDECFTTSDNLPEGIPDVVRHLYFLSPDHAKFFRHKFSLIEYGSLSNESLPERRPPGRPLELNNLRTIWFMDSPTISLSDASDDGFWNMSINYRRIINLRMLCLHHINCEALPVTIGDLIHLRYLDLRFSDIAELPESVRKLCHLQVLDVRSCKNLVKLPTGVNNLISIRHLLVDASSKLLAGYAGISYIGKLTSLQELDCFNVGKGNGFSIEQLKELREMGQSLAIGDLENVRNKEEASNSGVREKYRLVELNLLWNSNLKSRSSDVEISVLEGLQPHPNLRHLRIINYRGSTSPTWLATDLHTKYLESLYLHDCSGWEMLPPLGQLPYLRRLHFTGMGSILSIGPELYGSGSLMGFPCLEELHFENMLEWRSWCGVEKECFFPKLLTLTIMDCPSLQMLPVEQWSDQVNYKWFPCLEMLDIQNCPSLDQLPPLPHSSTLSRISLKNAGIISLMELNDEEIVISGISDLVLERQLFLPFHNLRSLKSFSIPGCDNFMVLPLKGQGKHDISEVSTTMDDSGSSLSNISELKICGSGISEDVLHEILSNVGILDCLSIKDCPQVTSLELNPMVRLDYLIIEDCLELTTLKCMKTLIHLTELTVLRSPKFMEGWKNLVEEAEGSHLRITASLKRLHIDDLSFLTMPICRTLGYLQYLMIDTDQQTICLTPEQEQAFGTLTSLKTLVFSECSYLRSLPATLHQISSLKSLHLSSCESIDSLPHLGLPGSLERLFIAGCDLLRDKCVEGGIDQHKIAHVRETILA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
71-1142 PTHR11017:SF28

WDLKSSAYDAEDVLDELDYFRLMEIVDNRSENKLAASIGLSIPKALRNTFDQPGTHLPRTFDSTKLRCSSLFPPFKKARPTFDYVSCDWDSVSCKMKSISDRLQRATAHIERVAQFKKLVADDMQQPKFPNSRQTSSLLTEPEVYGRDEEKNTIVKILLETKFSNIQNRYKSFLVLPVVGIGGVGKTTLVQYVYNDLATITCFEVRAWACVSGFLDVKQVTIDILQSIDEEGHNQFISSLSLNNIQTMLVKKLKKRKFLIVLDDVWSCSNWELLCAPLSSGTPGSKIIITTRHHNIANTVGTIPSVILGGLQDSPFWSFFKQNAFGDANMVDNLNLIGRKIASKLNGIPLAAKTIGKLLHKQLTTEHWMSILDSNLWELRQGPEDIMPVLLLSYQHLPANIQRCFVFCSAFPKDYSFCEEELIFSWMAHGFIQCMRRDKTLEDTAREYLYELASASFFQVSSNDNLYRMHDLLHDLASSLSKDECFTTSDNLPEGIPDVVRHLYFLSPDHAKFFRHKFSLIEYGSLSNESLPERRPPGRPLELNNLRTIWFMDSPTISLSDASDDGFWNMSINYRRIINLRMLCLHHINCEALPVTIGDLIHLRYLDLRFSDIAELPESVRKLCHLQVLDVRSCKNLVKLPTGVNNLISIRHLLVDASSKLLAGYAGISYIGKLTSLQELDCFNVGKGNGFSIEQLKELREMGQSLAIGDLENVRNKEEASNSGVREKYRLVELNLLWNSNLKSRSSDVEISVLEGLQPHPNLRHLRIINYRGSTSPTWLATDLHTKYLESLYLHDCSGWEMLPPLGQLPYLRRLHFTGMGSILSIGPELYGSGSLMGFPCLEELHFENMLEWRSWCGVEKECFFPKLLTLTIMDCPSLQMLPVEQWSDQVNYKWFPCLEMLDIQNCPSLDQLPPLPHSSTLSRISLKNAGIISLMELNDEEIVISGISDLVLERQLFLPFHNLRSLKSFSIPGCDNFMVLPLKGQGKHDISEVSTTMDDSGSSLSNISELKICGSGISEDVLHEILSNVGILDCLSIKDCPQVTSLELNPMVRLDYLIIEDCLELTTLKCM

HMMPanther: PTHR11017
71-1142 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

WDLKSSAYDAEDVLDELDYFRLMEIVDNRSENKLAASIGLSIPKALRNTFDQPGTHLPRTFDSTKLRCSSLFPPFKKARPTFDYVSCDWDSVSCKMKSISDRLQRATAHIERVAQFKKLVADDMQQPKFPNSRQTSSLLTEPEVYGRDEEKNTIVKILLETKFSNIQNRYKSFLVLPVVGIGGVGKTTLVQYVYNDLATITCFEVRAWACVSGFLDVKQVTIDILQSIDEEGHNQFISSLSLNNIQTMLVKKLKKRKFLIVLDDVWSCSNWELLCAPLSSGTPGSKIIITTRHHNIANTVGTIPSVILGGLQDSPFWSFFKQNAFGDANMVDNLNLIGRKIASKLNGIPLAAKTIGKLLHKQLTTEHWMSILDSNLWELRQGPEDIMPVLLLSYQHLPANIQRCFVFCSAFPKDYSFCEEELIFSWMAHGFIQCMRRDKTLEDTAREYLYELASASFFQVSSNDNLYRMHDLLHDLASSLSKDECFTTSDNLPEGIPDVVRHLYFLSPDHAKFFRHKFSLIEYGSLSNESLPERRPPGRPLELNNLRTIWFMDSPTISLSDASDDGFWNMSINYRRIINLRMLCLHHINCEALPVTIGDLIHLRYLDLRFSDIAELPESVRKLCHLQVLDVRSCKNLVKLPTGVNNLISIRHLLVDASSKLLAGYAGISYIGKLTSLQELDCFNVGKGNGFSIEQLKELREMGQSLAIGDLENVRNKEEASNSGVREKYRLVELNLLWNSNLKSRSSDVEISVLEGLQPHPNLRHLRIINYRGSTSPTWLATDLHTKYLESLYLHDCSGWEMLPPLGQLPYLRRLHFTGMGSILSIGPELYGSGSLMGFPCLEELHFENMLEWRSWCGVEKECFFPKLLTLTIMDCPSLQMLPVEQWSDQVNYKWFPCLEMLDIQNCPSLDQLPPLPHSSTLSRISLKNAGIISLMELNDEEIVISGISDLVLERQLFLPFHNLRSLKSFSIPGCDNFMVLPLKGQGKHDISEVSTTMDDSGSSLSNISELKICGSGISEDVLHEILSNVGILDCLSIKDCPQVTSLELNPMVRLDYLIIEDCLELTTLKCM

superfamily: SSF52540
197-451 SSF52540

PKFPNSRQTSSLLTEPEVYGRDEEKNTIVKILLETKFSNIQNRYKSFLVLPVVGIGGVGKTTLVQYVYNDLATITCFEVRAWACVSGFLDVKQVTIDILQSIDEEGHNQFISSLSLNNIQTMLVKKLKKRKFLIVLDDVWSCSNWELLCAPLSSGTPGSKIIITTRHHNIANTVGTIPSVILGGLQDSPFWSFFKQNAFGDANMVDNLNLIGRKIASKLNGIPLAAKTIGKLLHKQLTTEHWMSILDSNLWELRQ

Gene3D: G3DSA:3.40.50.300
213-342 G3DSA:3.40.50.300

EVYGRDEEKNTIVKILLETKFSNIQNRYKSFLVLPVVGIGGVGKTTLVQYVYNDLATITCFEVRAWACVSGFLDVKQVTIDILQSIDEEGHNQFISSLSLNNIQTMLVKKLKKRKFLIVLDDVWSCSNWE

HMMPfam: PF00931
IPR002182
241-503 NB-ARC,NBS
NB-ARC

KSFLVLPVVGIGGVGKTTLVQYVYNDLATITCFEVRAWACVSGFLDVKQVTIDILQSIDEEGHNQFISSLSLNNIQTMLVKKLKKRKFLIVLDDVWSCSNWELLCAPLSSGTPGSKIIITTRHHNIANTVGTIPSVILGGLQDSPFWSFFKQNAFGDANMVDNLNLIGRKIASKLNGIPLAAKTIGKLLHKQLTTEHWMSILDSNLWELRQGPEDIMPVLLLSYQHLPANIQRCFVFCSAFPKDYSFCEEELIFSWMAHGFIQ

FPrintScan: PR00364
IPR000767
245-260 DISEASERSIST
Disease resistance protein

VLPVVGIGGVGKTTLV

FPrintScan: PR00364
IPR000767
322-336 DISEASERSIST
Disease resistance protein

KLKKRKFLIVLDDVW

FPrintScan: PR00364
IPR000767
415-429 DISEASERSIST
Disease resistance protein

LNGIPLAAKTIGKLL

superfamily: SSF52058
538-1046 SSF52058,LRR

RMHDLLHDLASSLSKDECFTTSDNLPEGIPDVVRHLYFLSPDHAKFFRHKFSLIEYGSLSNESLPERRPPGRPLELNNLRTIWFMDSPTISLSDASDDGFWNMSINYRRIINLRMLCLHHINCEALPVTIGDLIHLRYLDLRFSDIAELPESVRKLCHLQVLDVRSCKNLVKLPTGVNNLISIRHLLVDASSKLLAGYAGISYIGKLTSLQELDCFNVGKGNGFSIEQLKELREMGQSLAIGDLENVRNKEEASNSGVREKYRLVELNLLWNSNLKSRSSDVEISVLEGLQPHPNLRHLRIINYRGSTSPTWLATDLHTKYLESLYLHDCSGWEMLPPLGQLPYLRRLHFTGMGSILSIGPELYGSGSLMGFPCLEELHFENMLEWRSWCGVEKECFFPKLLTLTIMDCPSLQMLPVEQWSDQVNYKWFPCLEMLDIQNCPSLDQLPPLPHSSTLSRISLKNAGIISLMELNDEEIVISGISDLVLERQLFLPFHNLRSLKSFSIPGCD

Gene3D: G3DSA:3.80.10.10
645-746 G3DSA:3.80.10.10

RRIINLRMLCLHHINCEALPVTIGDLIHLRYLDLRFSDIAELPESVRKLCHLQVLDVRSCKNLVKLPTGVNNLISIRHLLVDASSKLLAGYAGISYIGKLTS

FPrintScan: PR00364
IPR000767
691-707 DISEASERSIST
Disease resistance protein

RKLCHLQVLDVRSCKNL

Gene3D: G3DSA:3.80.10.10
747-948 G3DSA:3.80.10.10

LQELDCFNVGKGNGFSIEQLKELREMGQSLAIGDLENVRNKEEASNSGVREKYRLVELNLLWNSNLKSRSSDVEISVLEGLQPHPNLRHLRIINYRGSTSPTWLATDLHTKYLESLYLHDCSGWEMLPPLGQLPYLRRLHFTGMGSILSIGPELYGSGSLMGFPCLEELHFENMLEWRSWCGVEKECFFPKLLTLTIMDCPS

Gene3D: G3DSA:3.80.10.10
966-1166 G3DSA:3.80.10.10

FPCLEMLDIQNCPSLDQLPPLPHSSTLSRISLKNAGIISLMELNDEEIVISGISDLVLERQLFLPFHNLRSLKSFSIPGCDNFMVLPLKGQGKHDISEVSTTMDDSGSSLSNISELKICGSGISEDVLHEILSNVGILDCLSIKDCPQVTSLELNPMVRLDYLIIEDCLELTTLKCMKTLIHLTELTVLRSPKFMEGWKNL

superfamily: SSF52047
1020-1312 SSF52047,LRR

DLVLERQLFLPFHNLRSLKSFSIPGCDNFMVLPLKGQGKHDISEVSTTMDDSGSSLSNISELKICGSGISEDVLHEILSNVGILDCLSIKDCPQVTSLELNPMVRLDYLIIEDCLELTTLKCMKTLIHLTELTVLRSPKFMEGWKNLVEEAEGSHLRITASLKRLHIDDLSFLTMPICRTLGYLQYLMIDTDQQTICLTPEQEQAFGTLTSLKTLVFSECSYLRSLPATLHQISSLKSLHLSSCESIDSLPHLGLPGSLERLFIAGCDLLRDKCVEGGIDQHKIAHVRETILA

Gene3D: G3DSA:3.80.10.10
1180-1294 G3DSA:3.80.10.10

SLKRLHIDDLSFLTMPICRTLGYLQYLMIDTDQQTICLTPEQEQAFGTLTSLKTLVFSECSYLRSLPATLHQISSLKSLHLSSCESIDSLPHLGLPGSLERLFIAGCDLLRDKCV


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox